Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ST5Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ST5 Polyclonal Antibody | anti-ST5 antibody

ST5 Antibody - middle region

Gene Names
ST5; HTS1; p126; DENND2B
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ST5; Polyclonal Antibody; ST5 Antibody - middle region; anti-ST5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KLSMSSIETASLRDENSESESDSDDRFKAHTQRLVHIQSMLKRAPSYRTL
Sequence Length
717
Applicable Applications for anti-ST5 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ST5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ST5Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ST5Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ST5 antibody
This gene was identified by its ability to suppress the tumorigenicity of Hela cells in nude mice. The protein encoded by this gene contains a C-terminal region that shares similarity with the Rab 3 family of small GTP binding proteins. This protein preferentially binds to the SH3 domain of c-Abl kinase, and acts as a regulator of MAPK1/ERK2 kinase, which may contribute to its ability to reduce the tumorigenic phenotype in cells. Three alternatively spliced transcript variants of this gene encoding distinct isoforms are identified.
Product Categories/Family for anti-ST5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78 kDa
NCBI Official Full Name
suppression of tumorigenicity 5 protein isoform 1
NCBI Official Synonym Full Names
suppression of tumorigenicity 5
NCBI Official Symbol
ST5
NCBI Official Synonym Symbols
HTS1; p126; DENND2B
NCBI Protein Information
suppression of tumorigenicity 5 protein
UniProt Protein Name
Suppression of tumorigenicity 5 protein
UniProt Gene Name
ST5
UniProt Synonym Gene Names
DENND2B; HTS1
UniProt Entry Name
ST5_HUMAN

NCBI Description

This gene was identified by its ability to suppress the tumorigenicity of Hela cells in nude mice. The protein encoded by this gene contains a C-terminal region that shares similarity with the Rab 3 family of small GTP binding proteins. This protein preferentially binds to the SH3 domain of c-Abl kinase, and acts as a regulator of MAPK1/ERK2 kinase, which may contribute to its ability to reduce the tumorigenic phenotype in cells. Three alternatively spliced transcript variants of this gene encoding distinct isoforms are identified. [provided by RefSeq, Jul 2008]

Uniprot Description

DENND2B: a guanine nucleotide exchange factor (GEF) that may activate RAB9A and RAB9B. May be involved in cytoskeletal organization and tumorogenicity. Widely expressed with the exception of peripheral blood lymphocytes and lymphoid cell lines. 3 isoforms of the human protein are produced by alternative promoter. Isoform 1 interacts with the SH3 domain of ABL1, is expressed in several epithelial, fibroblast, and tumorigenic cell lines, and seems to be involved in the activation of ERK2. Isoform 3, expressed in primary cells that may be weakly tumorigenic, but not in tumorigenic cell lines, may block ERK2 activation stimulated by ABL1, and may alter cell morphology and cell growth.

Protein type: GEFs; GEFs, Rab

Chromosomal Location of Human Ortholog: 11p15

Molecular Function: Rab guanyl-nucleotide exchange factor activity

Research Articles on ST5

Similar Products

Product Notes

The ST5 st5 (Catalog #AAA3222315) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ST5 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ST5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ST5 st5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KLSMSSIETA SLRDENSESE SDSDDRFKAH TQRLVHIQSM LKRAPSYRTL. It is sometimes possible for the material contained within the vial of "ST5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.