Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: WIPI2Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human WIPI2 Polyclonal Antibody | anti-WIPI2 antibody

WIPI2 Antibody - N-terminal region

Gene Names
WIPI2; Atg21; ATG18B; CGI-50; WIPI-2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
WIPI2; Polyclonal Antibody; WIPI2 Antibody - N-terminal region; anti-WIPI2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LFANFNQDNTEVKGASRAAGLGRRAVVWSLAVGSKSGYKFFSLSSVDKLE
Sequence Length
443
Applicable Applications for anti-WIPI2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human WIPI2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: WIPI2Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: WIPI2Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-WIPI2 antibody
WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins, such as WIPI2, have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids.
Product Categories/Family for anti-WIPI2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48 kDa
NCBI Official Full Name
WD repeat domain phosphoinositide-interacting protein 2 isoform c
NCBI Official Synonym Full Names
WD repeat domain, phosphoinositide interacting 2
NCBI Official Symbol
WIPI2
NCBI Official Synonym Symbols
Atg21; ATG18B; CGI-50; WIPI-2
NCBI Protein Information
WD repeat domain phosphoinositide-interacting protein 2
UniProt Protein Name
WD repeat domain phosphoinositide-interacting protein 2
UniProt Gene Name
WIPI2
UniProt Synonym Gene Names
WIPI-2
UniProt Entry Name
WIPI2_HUMAN

NCBI Description

WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI subfamily of WD40 repeat proteins, such as WIPI2, have a 7-bladed propeller structure and contain a conserved motif for interaction with phospholipids (Proikas-Cezanne et al., 2004 [PubMed 15602573]).[supplied by OMIM, Mar 2008]

Uniprot Description

WIPI2: Probable early component of the autophagy machinery being involved in formation of preautophagosomal structures and their maturation into mature phagosomes in response to PtdIns3P. May bind PtdIns3P. Interacts with TECPR1. Ubiquitously expressed. Highly expressed in heart, skeletal muscle and pancreas. Expression is down-regulated in pancreatic and in kidney tumors. Belongs to the WD repeat SVP1 family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Autophagy

Chromosomal Location of Human Ortholog: 7p22.1

Cellular Component: nucleoplasm; protein complex; extrinsic to membrane; pre-autophagosomal structure membrane; cytoplasm; autophagic vacuole; cytosol

Molecular Function: protein binding; phosphatidylinositol 3-phosphate binding

Biological Process: autophagic vacuole fusion; protein amino acid lipidation; mitochondrion degradation; cellular response to nitrogen starvation; autophagic vacuole formation

Research Articles on WIPI2

Similar Products

Product Notes

The WIPI2 wipi2 (Catalog #AAA3221977) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WIPI2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WIPI2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WIPI2 wipi2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LFANFNQDNT EVKGASRAAG LGRRAVVWSL AVGSKSGYKF FSLSSVDKLE. It is sometimes possible for the material contained within the vial of "WIPI2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.