Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SEMA4DSample Tissue: Human ACHNWhole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SEMA4D Polyclonal Antibody | anti-SEMA4D antibody

SEMA4D Antibody - middle region

Gene Names
SEMA4D; CD100; COLL4; SEMAJ; coll-4; C9orf164; M-sema-G
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SEMA4D; Polyclonal Antibody; SEMA4D Antibody - middle region; anti-SEMA4D antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSPDSPDGEDDRVYFFFTE
Sequence Length
862
Applicable Applications for anti-SEMA4D antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SEMA4D
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SEMA4DSample Tissue: Human ACHNWhole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SEMA4DSample Tissue: Human ACHNWhole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SEMA4D antibody
Cell surface receptor for PLXN1B and PLXNB2 that plays an important role in cell-cell signaling. Promotes reorganization of the actin cytoskeleton and plays a role in axonal growth cone guidance in the developing central nervous system. Regulates dendrite and axon branching and morphogenesis. Promotes the migration of cerebellar granule cells and of endothelial cells. Plays a role in the immune system; induces B-cells to aggregate and improves their viability (in vitro). Promotes signaling via SRC and PTK2B/PYK2, which then mediates activation of phosphatidylinositol 3-kinase and of the AKT1 signaling cascade. Interaction with PLXNB1 mediates activation of RHOA.
Product Categories/Family for anti-SEMA4D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94 kDa
NCBI Official Full Name
semaphorin-4D isoform 2
NCBI Official Synonym Full Names
semaphorin 4D
NCBI Official Symbol
SEMA4D
NCBI Official Synonym Symbols
CD100; COLL4; SEMAJ; coll-4; C9orf164; M-sema-G
NCBI Protein Information
semaphorin-4D
UniProt Protein Name
Semaphorin-4D
Protein Family
UniProt Gene Name
SEMA4D
UniProt Synonym Gene Names
C9orf164; CD100; SEMAJ
UniProt Entry Name
SEM4D_HUMAN

Uniprot Description

SEMA4D: a single-pass type I membrane protein that my play a functional role in the immune system, as well as in the nervous system. Induces B-cells to aggregate and improves their viability in vitro.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 9q22.2

Cellular Component: extracellular space; integral to plasma membrane; plasma membrane

Molecular Function: protein binding; transmembrane receptor activity; receptor activity; semaphorin receptor binding; receptor binding

Biological Process: axon guidance; negative regulation of peptidyl-tyrosine phosphorylation; regulation of dendrite morphogenesis; negative regulation of transcription from RNA polymerase II promoter; negative regulation of cell adhesion; positive regulation of phosphoinositide 3-kinase cascade; regulation of cell shape; positive regulation of peptidyl-tyrosine phosphorylation; negative regulation of osteoblast differentiation; immune response; positive regulation of protein amino acid phosphorylation; cell adhesion; positive regulation of collateral sprouting; regulation of cell projection organization and biogenesis; negative regulation of apoptosis; positive regulation of cell migration

Research Articles on SEMA4D

Similar Products

Product Notes

The SEMA4D sema4d (Catalog #AAA3221595) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SEMA4D Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SEMA4D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SEMA4D sema4d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ISRNSSHSPL RTEYAIPWLN EPSFVFADVI RKSPDSPDGE DDRVYFFFTE. It is sometimes possible for the material contained within the vial of "SEMA4D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.