Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Human HLA-DQA1 Polyclonal Antibody | anti-HLA-DQA1 antibody

HLA-DQA1 Antibody - middle region

Gene Names
HLA-DQA1; DQA1; DQ-A1; CELIAC1; HLA-DQA
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
HLA-DQA1; Polyclonal Antibody; HLA-DQA1 Antibody - middle region; anti-HLA-DQA1 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALT
Sequence Length
254
Applicable Applications for anti-HLA-DQA1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HLA-DQA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HLA-DQA1Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-HLA-DQA1 antibody
HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells. The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation
Product Categories/Family for anti-HLA-DQA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27 kDa
NCBI Official Full Name
HLA class II histocompatibility antigen, DQ alpha 1 chain
NCBI Official Synonym Full Names
major histocompatibility complex, class II, DQ alpha 1
NCBI Official Symbol
HLA-DQA1
NCBI Official Synonym Symbols
DQA1; DQ-A1; CELIAC1; HLA-DQA
NCBI Protein Information
HLA class II histocompatibility antigen, DQ alpha 1 chain
UniProt Protein Name
HLA class II histocompatibility antigen, DQ alpha 1 chain
UniProt Gene Name
HLA-DQA1
UniProt Entry Name
DQA1_HUMAN

NCBI Description

HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B Lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. [provided by RefSeq, Jul 2008]

Uniprot Description

HLA-DQA1 iso4:

Protein type: Membrane protein, integral; Cell surface

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: Golgi membrane; membrane; lysosomal membrane; integral to plasma membrane; plasma membrane; trans-Golgi network membrane; endosome membrane; MHC class II protein complex; external side of plasma membrane

Molecular Function: MHC class II receptor activity; peptide antigen binding

Biological Process: positive regulation of T cell differentiation; cytokine and chemokine mediated signaling pathway; T cell costimulation; antigen processing and presentation of exogenous peptide antigen via MHC class II; immune response; T cell receptor signaling pathway

Research Articles on HLA-DQA1

Similar Products

Product Notes

The HLA-DQA1 hla-dqa1 (Catalog #AAA3221510) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HLA-DQA1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HLA-DQA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HLA-DQA1 hla-dqa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NLYQSYGPSG QYTHEFDGDE QFYVDLGRKE TVWCLPVLRQ FRFDPQFALT. It is sometimes possible for the material contained within the vial of "HLA-DQA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual