Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DIS3LSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human DIS3L Polyclonal Antibody | anti-DIS3L antibody

DIS3L Antibody - middle region

Gene Names
DIS3L; DIS3L1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DIS3L; Polyclonal Antibody; DIS3L Antibody - middle region; anti-DIS3L antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAHELCDSILQSRRERENESQESHGKEYPEHLPLEVLEAGIKSGRYIQGI
Sequence Length
971
Applicable Applications for anti-DIS3L antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DIS3L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DIS3LSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DIS3LSample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-DIS3L antibody
Putative cytoplasm-specific catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA.
Product Categories/Family for anti-DIS3L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
106 kDa
NCBI Official Full Name
DIS3-like exonuclease 1 isoform 1
NCBI Official Synonym Full Names
DIS3 like exosome 3'-5' exoribonuclease
NCBI Official Symbol
DIS3L
NCBI Official Synonym Symbols
DIS3L1
NCBI Protein Information
DIS3-like exonuclease 1
UniProt Protein Name
DIS3-like exonuclease 1
Protein Family
UniProt Gene Name
DIS3L
UniProt Synonym Gene Names
DIS3L1; KIAA1955
UniProt Entry Name
DI3L1_HUMAN

NCBI Description

The cytoplasmic RNA exosome complex degrades unstable mRNAs and is involved in the regular turnover of other mRNAs. The protein encoded by this gene contains 3'-5' exoribonuclease activity and is a catalytic component of this complex. [provided by RefSeq, May 2016]

Uniprot Description

Function: Putative cytoplasm-specific catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. Ref.6 Ref.7

Cofactor: Magnesium. Ref.6 Ref.7

Subunit structure: Component of the RNA exosome complex. The catalytically inactive RNA exosome core (Exo-9) complex is believed to associate with catalytic subunits EXOSC10, and DIS3 or DIS3L in cytoplasmic- and nuclear-specific RNA exosome complex forms.

Subcellular location: Cytoplasm Ref.6 Ref.7.

Sequence similarities: Belongs to the RNR ribonuclease family.

Sequence caution: The sequence BAB85541.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Research Articles on DIS3L

Similar Products

Product Notes

The DIS3L dis3l (Catalog #AAA3221406) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DIS3L Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DIS3L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DIS3L dis3l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAHELCDSIL QSRRERENES QESHGKEYPE HLPLEVLEAG IKSGRYIQGI. It is sometimes possible for the material contained within the vial of "DIS3L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.