Western Blot (WB)
(Host: RabbitTarget Name: PDCD1LG2Sample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human PDCD1LG2 Polyclonal Antibody | anti-PDCD1LG2 antibody
PDCD1LG2 Antibody - middle region
Gene Names
PDCD1LG2; B7DC; Btdc; PDL2; CD273; PD-L2; PDCD1L2; bA574F11.2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PDCD1LG2; Polyclonal Antibody; PDCD1LG2 Antibody - middle region; anti-PDCD1LG2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQL
Sequence Length
183
Applicable Applications for anti-PDCD1LG2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PDCD1LG2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PDCD1LG2Sample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PDCD1LG2Sample Tissue: Human ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PDCD1LG2 antibody
Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production (By similarity).
Product Categories/Family for anti-PDCD1LG2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21 kDa
NCBI Official Full Name
programmed cell death 1 ligand 2
NCBI Official Synonym Full Names
programmed cell death 1 ligand 2
NCBI Official Symbol
PDCD1LG2
NCBI Official Synonym Symbols
B7DC; Btdc; PDL2; CD273; PD-L2; PDCD1L2; bA574F11.2
NCBI Protein Information
programmed cell death 1 ligand 2
UniProt Protein Name
Programmed cell death 1 ligand 2
Protein Family
UniProt Gene Name
PDCD1LG2
UniProt Synonym Gene Names
B7DC; CD273; PDCD1L2; PDL2; PD-1 ligand 2; PD-L2; PDCD1 ligand 2; Programmed death ligand 2; B7-DC
UniProt Entry Name
PD1L2_HUMAN
Uniprot Description
PDCD1LG2: Involved in the costimulatory signal, essential for T- cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production. Belongs to the immunoglobulin superfamily. BTN/MOG family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral; Receptor, misc.
Chromosomal Location of Human Ortholog: 9p24.2
Cellular Component: plasma membrane
Biological Process: negative regulation of activated T cell proliferation; negative regulation of interferon-gamma production; negative regulation of interleukin-10 production; T cell costimulation
Research Articles on PDCD1LG2
Similar Products
Product Notes
The PDCD1LG2 pdcd1lg2 (Catalog #AAA3221393) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDCD1LG2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDCD1LG2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDCD1LG2 pdcd1lg2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IIEHGSNVTL ECNFDTGSHV NLGAITASLQ KVENDTSPHR ERATLLEEQL. It is sometimes possible for the material contained within the vial of "PDCD1LG2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
