Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MESDC2Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MESD Polyclonal Antibody | anti-MESD antibody

MESD Antibody - middle region

Gene Names
MESD; BOCA; MESDC2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MESD; Polyclonal Antibody; MESD Antibody - middle region; anti-MESD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LPPPGSCAAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDD
Sequence Length
234
Applicable Applications for anti-MESD antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MESDC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MESDC2Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MESDC2Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Product Categories/Family for anti-MESD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26 kDa
NCBI Official Full Name
LRP chaperone MESD
NCBI Official Synonym Full Names
mesoderm development LRP chaperone
NCBI Official Symbol
MESD
NCBI Official Synonym Symbols
BOCA; MESDC2
NCBI Protein Information
LRP chaperone MESD
UniProt Protein Name
LDLR chaperone MESD
UniProt Gene Name
MESDC2
UniProt Synonym Gene Names
KIAA0081; MESD
UniProt Entry Name
MESD_HUMAN

Uniprot Description

MESDC2: Chaperone specifically assisting the folding of beta- propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs). Acts as a modulator of the Wnt pathway through chaperoning the coreceptors of the canonical Wnt pathway, LRP5 and LRP6, to the plasma membrane. Essential for specification of embryonic polarity and mesoderm induction. Monomer. Interacts with LRP5; the interaction prevents LRP5 from forming aggregates and chaperones LRP6 to the plasma membrane. Interacts with LRP6; the interaction prevents LRP6 from forming aggregates and chaperones LRP6 to the plasma membrane. Belongs to the MESD family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 15q13

Cellular Component: endoplasmic reticulum; plasma membrane

Molecular Function: low-density lipoprotein receptor binding

Biological Process: Wnt receptor signaling pathway; protein folding; mesoderm development

Research Articles on MESD

Similar Products

Product Notes

The MESD mesdc2 (Catalog #AAA3221300) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MESD Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MESD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MESD mesdc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LPPPGSCAAE GSPGTPDEST PPPRKKKKDI RDYNDADMAR LLEQWEKDDD. It is sometimes possible for the material contained within the vial of "MESD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.