Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TAGLN2Sample Tissue: Human A172 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TAGLN2 Polyclonal Antibody | anti-TAGLN2 antibody

TAGLN2 Antibody - middle region

Gene Names
TAGLN2; HA1756
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TAGLN2; Polyclonal Antibody; TAGLN2 Antibody - middle region; anti-TAGLN2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CVQRTLMNLGGLAVARDDGLFSGDPNWFPKKSKENPRNFSDNQLQEGKNV
Sequence Length
220
Applicable Applications for anti-TAGLN2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TAGLN2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TAGLN2Sample Tissue: Human A172 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TAGLN2Sample Tissue: Human A172 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TAGLN2 antibody
The protein encoded by this gene is similar to the protein transgelin, which is one of the earliest markers of differentiated smooth muscle. The specific function of this protein has not yet been determined, although it is thought to be a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-TAGLN2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24 kDa
NCBI Official Full Name
transgelin-2 isoform b
NCBI Official Synonym Full Names
transgelin 2
NCBI Official Symbol
TAGLN2
NCBI Official Synonym Symbols
HA1756
NCBI Protein Information
transgelin-2
UniProt Protein Name
Transgelin-2
Protein Family
UniProt Gene Name
TAGLN2
UniProt Synonym Gene Names
KIAA0120
UniProt Entry Name
TAGL2_HUMAN

NCBI Description

The protein encoded by this gene is similar to the protein transgelin, which is one of the earliest markers of differentiated smooth muscle. The specific function of this protein has not yet been determined, although it is thought to be a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2013]

Uniprot Description

TAGLN2: a cytoskeletal protein of the calponin family. One of the earliest markers of differentiated smooth muscle. Expressed in the smooth, cardiac, and skeletal muscle cells during early embryogenesis. Becomes restricted to vascular and visceral smooth muscle cells in late fetal development and adulthood. Its expression is abolished by activated Ras. Ras-dependent and Ras-independent mechanisms can cause the down-regulation of transgelin in breast and colon cancer cells lines and tumor samples.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1q21-q25

Cellular Component: vesicle

Molecular Function: actin filament binding; protein binding

Biological Process: epithelial cell differentiation

Research Articles on TAGLN2

Similar Products

Product Notes

The TAGLN2 tagln2 (Catalog #AAA3221283) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAGLN2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAGLN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TAGLN2 tagln2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CVQRTLMNLG GLAVARDDGL FSGDPNWFPK KSKENPRNFS DNQLQEGKNV. It is sometimes possible for the material contained within the vial of "TAGLN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.