Western Blot (WB)
(Host: RabbitTarget Name: RAD51L1Sample Tissue: Human Liver Tumor lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human RAD51B Polyclonal Antibody | anti-RAD51B antibody
RAD51B Antibody - middle region
Gene Names
RAD51B; REC2; R51H2; RAD51L1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RAD51B; Polyclonal Antibody; RAD51B Antibody - middle region; anti-RAD51B antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: EFDAQLQGNLKERNKFLAREASSLKYLAEEFSIPVILTNQITTHLSGALA
Sequence Length
279
Applicable Applications for anti-RAD51B antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RAD51B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: RAD51L1Sample Tissue: Human Liver Tumor lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RAD51L1Sample Tissue: Human Liver Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RAD51B antibody
The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are evolutionarily conserved proteins essential for DNA repair by homologous recombination. This protein has been shown to form a stable heterodimer with the family member RAD51C, which further interacts with the other family members, such as RAD51, XRCC2, and XRCC3. Overexpression of this gene was found to cause cell cycle G1 delay and cell apoptosis, which suggested a role of this protein in sensing DNA damage. At least three alternatively spliced transcript variants encoding distinct isoforms have been observed. Rearrangements between this locus and high mobility group AT-hook 2 (HMGA2, GeneID 8091) have been observed in uterine leiomyomata.
Product Categories/Family for anti-RAD51B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
30 kDa
NCBI Official Full Name
DNA repair protein RAD51 homolog 2 isoform 1
NCBI Official Synonym Full Names
RAD51 paralog B
NCBI Official Symbol
RAD51B
NCBI Official Synonym Symbols
REC2; R51H2; RAD51L1
NCBI Protein Information
DNA repair protein RAD51 homolog 2
Protein Family
NCBI Description
The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are evolutionarily conserved proteins essential for DNA repair by homologous recombination. This protein has been shown to form a stable heterodimer with the family member RAD51C, which further interacts with the other family members, such as RAD51, XRCC2, and XRCC3. Overexpression of this gene was found to cause cell cycle G1 delay and cell apoptosis, which suggested a role of this protein in sensing DNA damage. Rearrangements between this locus and high mobility group AT-hook 2 (HMGA2, GeneID 8091) have been observed in uterine leiomyomata. [provided by RefSeq, Mar 2016]
Research Articles on RAD51B
Similar Products
Product Notes
The RAD51B (Catalog #AAA3221063) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RAD51B Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAD51B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAD51B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EFDAQLQGNL KERNKFLARE ASSLKYLAEE FSIPVILTNQ ITTHLSGALA. It is sometimes possible for the material contained within the vial of "RAD51B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
