Western Blot (WB)
(Host: RabbitTarget Name: KDELC1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human KDELC1 Polyclonal Antibody | anti-KDELC1 antibody
KDELC1 Antibody - middle region
Gene Names
POGLUT2; EP58; ERp58; KDEL1; KDELC1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
KDELC1; Polyclonal Antibody; KDELC1 Antibody - middle region; anti-KDELC1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LFVNLGDWPLEKKKSNSNIHPIFSWCGSTDSKDIVMPTYDLTDSVLETMG
Sequence Length
982
Applicable Applications for anti-KDELC1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KDELC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: KDELC1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: KDELC1Sample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-KDELC1 antibody
This gene encodes a protein product localized to the lumen of the endoplasmic reticulum. As a member of the endoplasmic reticulum protein family the encoded protein contains a Lys-Asp-Glu-Leu or KDEL motif located at the extreme C-terminus which prevents all endoplasmic reticulum resident proteins from being secreted. Proteins carrying this motif are bound by a receptor in the Golgi apparatus so that the receptor-ligand complex returns to the endoplasmic reticulum. A processed non-transcribed pseudogene located in an intron of a sodium transporter gene on chromosome 5 has been defined for this gene.
Product Categories/Family for anti-KDELC1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58 kDa
NCBI Official Full Name
protein O-glucosyltransferase 2 isoform 1
NCBI Official Synonym Full Names
protein O-glucosyltransferase 2
NCBI Official Symbol
POGLUT2
NCBI Official Synonym Symbols
EP58; ERp58; KDEL1; KDELC1
NCBI Protein Information
protein O-glucosyltransferase 2; KDEL motif-containing protein 1
UniProt Protein Name
KDEL motif-containing protein 1
Protein Family
UniProt Gene Name
KDELC1
UniProt Synonym Gene Names
EP58; UNQ1910/PRO4357; ER protein 58; ERp58
UniProt Entry Name
KDEL1_HUMAN
NCBI Description
This gene encodes a protein product localized to the lumen of the endoplasmic reticulum. As a member of the endoplasmic reticulum protein family the encoded protein contains a Lys-Asp-Glu-Leu or KDEL motif located at the extreme C-terminus which prevents all endoplasmic reticulum resident proteins from being secreted. Proteins carrying this motif are bound by a receptor in the Golgi apparatus so that the receptor-ligand complex returns to the endoplasmic reticulum. A processed non-transcribed pseudogene located in an intron of a sodium transporter gene on chromosome 5 has been defined for this gene. This gene has multiple transcript variants which are predicted to encode distinct isoforms. [provided by RefSeq, Jan 2016]
Research Articles on KDELC1
Similar Products
Product Notes
The KDELC1 kdelc1 (Catalog #AAA3220713) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KDELC1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KDELC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KDELC1 kdelc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LFVNLGDWPL EKKKSNSNIH PIFSWCGSTD SKDIVMPTYD LTDSVLETMG. It is sometimes possible for the material contained within the vial of "KDELC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
