Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SNX3Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human SNX3 Polyclonal Antibody | anti-SNX3 antibody

SNX3 Antibody - N-terminal region

Gene Names
SNX3; SDP3; Grd19; MCOPS8
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SNX3; Polyclonal Antibody; SNX3 Antibody - N-terminal region; anti-SNX3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLP
Sequence Length
162
Applicable Applications for anti-SNX3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SNX3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SNX3Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SNX3Sample Tissue: Human ACHN Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SNX3 antibody
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like most family members. This protein interacts with phosphatidylinositol-3-phosphate, and is involved in protein trafficking. A pseudogene of this gene is present on the sex chromosomes. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product Categories/Family for anti-SNX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19 kDa
NCBI Official Full Name
sorting nexin-3 isoform d
NCBI Official Synonym Full Names
sorting nexin 3
NCBI Official Symbol
SNX3
NCBI Official Synonym Symbols
SDP3; Grd19; MCOPS8
NCBI Protein Information
sorting nexin-3
UniProt Protein Name
Sorting nexin-3
Protein Family
UniProt Gene Name
SNX3
UniProt Entry Name
SNX3_HUMAN

NCBI Description

This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like most family members. This protein interacts with phosphatidylinositol-3-phosphate, and is involved in protein trafficking. A pseudogene of this gene is present on the sex chromosomes. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2014]

Uniprot Description

SNX3: Phosphoinositide-binding protein required for multivesicular body formation. Specifically binds phosphatidylinositol 3-phosphate (PtdIns(P3)). Plays a role in protein transport between cellular compartments. Promotes stability and cell surface expression of epithelial sodium channel (ENAC) subunits SCNN1A and SCNN1G. Not involved in EGFR degradation. A chromosomal aberration involving SNX3 may be a cause of microphthalmia syndromic type 8 (MCOPS8). Translocation t(6;13)(q21;q12). Microphthalmia is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues (anophthalmia). In many cases, microphthalmia/anophthalmia occurs in association with syndromes that include non-ocular abnormalities. MCOPS8 is a very rare congenital syndrome characterized by microcephaly, microphthalmia, ectrodactyly of the lower limbs and prognathism. Intellectual deficit has been reported. Belongs to the sorting nexin family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 6q21

Cellular Component: extrinsic to membrane; intracellular membrane-bound organelle; clathrin-coated vesicle; retromer complex; early endosome membrane; cytoplasm; early endosome; endosome membrane; cytosol

Molecular Function: protein binding; phosphatidylinositol-5-phosphate binding; protein phosphatase binding; phosphatidylinositol 3-phosphate binding

Biological Process: hemoglobin biosynthetic process; negative regulation of phagocytosis; regulation of cellular protein metabolic process; regulation of intracellular protein transport; response to bacterium; negative regulation of virion penetration into host cell; vesicle organization and biogenesis; regulation of Wnt receptor signaling pathway; membrane invagination; transferrin transport; protein to membrane docking; negative regulation of protein transport; negative regulation of protein catabolic process

Disease: Microphthalmia, Syndromic 8

Research Articles on SNX3

Similar Products

Product Notes

The SNX3 snx3 (Catalog #AAA3220466) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNX3 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNX3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SNX3 snx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RRLITKPQNL NDAYGPPSNF LEIDVSNPQT VGVGRGRFTT YEIRVKTNLP. It is sometimes possible for the material contained within the vial of "SNX3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.