Western Blot (WB)
(Host: RabbitTarget Name: KHSRPSample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human KHSRP Polyclonal Antibody | anti-KHSRP antibody
KHSRP Antibody - middle region
Gene Names
KHSRP; p75; FBP2; KSRP; FUBP2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
KHSRP; Polyclonal Antibody; KHSRP Antibody - middle region; anti-KHSRP antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPHQYPPQGWGN
Sequence Length
167
Applicable Applications for anti-KHSRP antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KHSRP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: KHSRPSample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: KHSRPSample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-KHSRP antibody
The KHSRP gene encodes a multifunctional RNA-binding protein implicated in a variety of cellular processes, including transcription, alternative pre-mRNA splicing, and mRNA localization (Min et al., 1997 [PubMed 9136930]; Gherzi et al., 2004 [PubMed 15175153]).[supplied by OMIM, Apr 2010]
Product Categories/Family for anti-KHSRP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73 kDa
NCBI Official Full Name
far upstream element-binding protein 2 isoform 1
NCBI Official Synonym Full Names
KH-type splicing regulatory protein
NCBI Official Symbol
KHSRP
NCBI Official Synonym Symbols
p75; FBP2; KSRP; FUBP2
NCBI Protein Information
far upstream element-binding protein 2
UniProt Protein Name
Far upstream element-binding protein 2
Protein Family
UniProt Gene Name
KHSRP
UniProt Synonym Gene Names
FUBP2; FUSE-binding protein 2; KSRP
UniProt Entry Name
FUBP2_HUMAN
NCBI Description
The KHSRP gene encodes a multifunctional RNA-binding protein implicated in a variety of cellular processes, including transcription, alternative pre-mRNA splicing, and mRNA localization (Min et al., 1997 [PubMed 9136930]; Gherzi et al., 2004 [PubMed 15175153]).[supplied by OMIM, Apr 2010]
Research Articles on KHSRP
Similar Products
Product Notes
The KHSRP khsrp (Catalog #AAA3220461) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KHSRP Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KHSRP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KHSRP khsrp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CPVGPGPGGP GPAGPMGPFN PGPFNQGPPG APPHAGGPPP HQYPPQGWGN. It is sometimes possible for the material contained within the vial of "KHSRP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
