Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: XRCC3Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human XRCC3 Polyclonal Antibody | anti-XRCC3 antibody

XRCC3 Antibody - middle region

Gene Names
XRCC3; CMM6
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
XRCC3; Polyclonal Antibody; XRCC3 Antibody - middle region; anti-XRCC3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HQQKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLAL
Sequence Length
346
Applicable Applications for anti-XRCC3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human XRCC3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: XRCC3Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: XRCC3Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-XRCC3 antibody
This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene functionally complements Chinese hamster irs1SF, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents and is chromosomally unstable. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity. Alternatively spliced transcript variants encoding the same protein have been identified.
Product Categories/Family for anti-XRCC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
DNA repair protein XRCC3
NCBI Official Synonym Full Names
X-ray repair cross complementing 3
NCBI Official Symbol
XRCC3
NCBI Official Synonym Symbols
CMM6
NCBI Protein Information
DNA repair protein XRCC3
UniProt Protein Name
DNA repair protein XRCC3
Protein Family
UniProt Gene Name
XRCC3
UniProt Entry Name
XRCC3_HUMAN

NCBI Description

This gene encodes a member of the RecA/Rad51-related protein family that participates in homologous recombination to maintain chromosome stability and repair DNA damage. This gene functionally complements Chinese hamster irs1SF, a repair-deficient mutant that exhibits hypersensitivity to a number of different DNA-damaging agents and is chromosomally unstable. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

XRCC3: Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA, thought to repair chromosomal fragmentation, translocations and deletions. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51 and RAD51C. Defects in XRCC3 are the cause of susceptibility to breast cancer (BC). BC is a common malignancy originating from breast epithelial tissue. Breast neoplasms can be distinguished by their histologic pattern. Invasive ductal carcinoma is by far the most common type. Breast cancer is etiologically and genetically heterogeneous. Important genetic factors have been indicated by familial occurrence and bilateral involvement. Mutations at more than one locus can be involved in different families or even in the same case. Defects in XRCC3 are the cause of susceptibility to cutaneous malignant melanoma type 6 (CMM6). CMM6 is a malignant neoplasm of melanocytes, arising de novo or from a pre- existing benign nevus, which occurs most often in the skin but also may involve other sites. Belongs to the RecA family. RAD51 subfamily.

Protein type: DNA repair, damage

Chromosomal Location of Human Ortholog: 14q32.3

Cellular Component: mitochondrion; perinuclear region of cytoplasm; cytoplasm; replication fork; nucleus

Molecular Function: DNA-dependent ATPase activity; protein binding; four-way junction DNA binding; crossover junction endodeoxyribonuclease activity; ATP binding

Biological Process: response to organic substance; DNA repair; response to DNA damage stimulus; DNA catabolic process, endonucleolytic; double-strand break repair via homologous recombination; DNA recombination

Disease: Melanoma, Cutaneous Malignant, Susceptibility To, 6; Breast Cancer

Research Articles on XRCC3

Similar Products

Product Notes

The XRCC3 xrcc3 (Catalog #AAA3219868) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The XRCC3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's XRCC3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the XRCC3 xrcc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HQQKERFPTQ HQRLSLGCPV LDALLRGGLP LDGITELAGR SSAGKTQLAL. It is sometimes possible for the material contained within the vial of "XRCC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.