Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TK2Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TK2 Polyclonal Antibody | anti-TK2 antibody

TK2 Antibody - N-terminal region

Gene Names
TK2; MTTK; PEOB3; SCA31; MTDPS2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TK2; Polyclonal Antibody; TK2 Antibody - N-terminal region; anti-TK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 29% sucrose.
Sequence
Synthetic peptide located within the following region: RALRCFGPGSRGSPASGPGPRRVQRRAWPPDKEQEKEKKSVICVEGNIAS
Sequence Length
234
Applicable Applications for anti-TK2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TK2Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TK2Sample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TK2 antibody
This gene encodes a deoxyribonucleoside kinase that specifically phosphorylates thymidine, deoxycytidine, and deoxyuridine. The encoded enzyme localizes to the mitochondria and is required for mitochondrial DNA synthesis. Mutations in this gene are associated with a myopathic form of mitochondrial DNA depletion syndrome. Alternate splicing results in multiple transcript variants encoding distinct isoforms, some of which lack transit peptide, so are not localized to mitochondria.
Product Categories/Family for anti-TK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27 kDa
NCBI Official Full Name
thymidine kinase 2 isoform 2
NCBI Official Synonym Full Names
thymidine kinase 2
NCBI Official Symbol
TK2
NCBI Official Synonym Symbols
MTTK; PEOB3; SCA31; MTDPS2
NCBI Protein Information
thymidine kinase 2, mitochondrial; thymidine kinase 2
UniProt Protein Name
Thymidine kinase 2, mitochondrial
Protein Family
UniProt Gene Name
TK2
UniProt Entry Name
KITM_HUMAN

NCBI Description

This gene encodes a deoxyribonucleoside kinase that specifically phosphorylates thymidine, deoxycytidine, and deoxyuridine. The encoded enzyme localizes to the mitochondria and is required for mitochondrial DNA synthesis. Mutations in this gene are associated with a myopathic form of mitochondrial DNA depletion syndrome. Alternate splicing results in multiple transcript variants encoding distinct isoforms, some of which lack transit peptide, so are not localized to mitochondria. [provided by RefSeq, Dec 2012]

Uniprot Description

TK2: Deoxyribonucleoside kinase that phosphorylates thymidine, deoxycytidine, and deoxyuridine. Also phosphorylates anti-viral and anti-cancer nucleoside analogs. Defects in TK2 are a cause of mitochondrial DNA depletion syndrome type 2 (MTDPS2). A disorder characterized primarily by childhood onset of muscle weakness associated with depletion of mtDNA in skeletal muscle. There is wide clinical variability; some patients have onset in infancy and show a rapidly progressive course with early death due to respiratory failure, whereas others have later onset of a slowly progressive myopathy. Belongs to the DCK/DGK family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Xenobiotic Metabolism - drug metabolism - other enzymes; EC 2.7.1.21; Kinase, other; Mitochondrial; Nucleotide Metabolism - pyrimidine

Chromosomal Location of Human Ortholog: 16q22-q23.1

Cellular Component: mitochondrial matrix; mitochondrial inner membrane

Molecular Function: deoxycytidine kinase activity; thymidine kinase activity; ATP binding

Biological Process: deoxycytidine metabolic process; pyrimidine base metabolic process; nucleotide biosynthetic process; nucleobase, nucleoside and nucleotide metabolic process; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process; deoxyribonucleotide metabolic process; thymidine metabolic process; pyrimidine nucleoside salvage; mitochondrial DNA replication; phosphorylation; deoxyribonucleoside monophosphate biosynthetic process

Disease: Mitochondrial Dna Depletion Syndrome 2 (myopathic Type)

Research Articles on TK2

Similar Products

Product Notes

The TK2 tk2 (Catalog #AAA3219853) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TK2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TK2 tk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RALRCFGPGS RGSPASGPGP RRVQRRAWPP DKEQEKEKKS VICVEGNIAS. It is sometimes possible for the material contained within the vial of "TK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.