Western Blot (WB)
(Host: RabbitTarget Name: PIGTSample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human PIGT Polyclonal Antibody | anti-PIGT antibody
PIGT Antibody - middle region
Gene Names
PIGT; NDAP; PNH2; CGI-06; MCAHS3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PIGT; Polyclonal Antibody; PIGT Antibody - middle region; anti-PIGT antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 29% sucrose.
Sequence
Synthetic peptide located within the following region: ITSKGKENKPSYIHYQPAQDRLQPHLLEMLIQLPANSVTKVSIQFERALL
Sequence Length
578
Applicable Applications for anti-PIGT antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PIGT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PIGTSample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PIGTSample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PIGT antibody
This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for anti-PIGT antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64 kDa
NCBI Official Full Name
GPI transamidase component PIG-T isoform 2
NCBI Official Synonym Full Names
phosphatidylinositol glycan anchor biosynthesis class T
NCBI Official Symbol
PIGT
NCBI Official Synonym Symbols
NDAP; PNH2; CGI-06; MCAHS3
NCBI Protein Information
GPI transamidase component PIG-T
UniProt Protein Name
GPI transamidase component PIG-T
Protein Family
UniProt Gene Name
PIGT
UniProt Synonym Gene Names
CGI-06; PSEC0163; UNQ716/PRO1379
UniProt Entry Name
PIGT_HUMAN
NCBI Description
This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012]
Research Articles on PIGT
Similar Products
Product Notes
The PIGT pigt (Catalog #AAA3219813) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIGT Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIGT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PIGT pigt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ITSKGKENKP SYIHYQPAQD RLQPHLLEML IQLPANSVTK VSIQFERALL. It is sometimes possible for the material contained within the vial of "PIGT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
