Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Human GAD1 Polyclonal Antibody | anti-GAD1 antibody

GAD1 Antibody - N-terminal region

Gene Names
GAD1; GAD; SCP; CPSQ1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GAD1; Polyclonal Antibody; GAD1 Antibody - N-terminal region; anti-GAD1 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 16% sucrose.
Sequence
Synthetic peptide located within the following region: CENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEVVDILLNYV
Sequence Length
594
Applicable Applications for anti-GAD1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GAD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GAD1Sample Tissue: 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-GAD1 antibody
This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantigen and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Deficiency in this enzyme has been shown to lead to pyridoxine dependency with seizures. Alternative splicing of this gene results in two products, the predominant 67-kD form and a less-frequent 25-kD form.
Product Categories/Family for anti-GAD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65 kDa
NCBI Official Full Name
glutamate decarboxylase 1 isoform GAD67
NCBI Official Synonym Full Names
glutamate decarboxylase 1
NCBI Official Symbol
GAD1
NCBI Official Synonym Symbols
GAD; SCP; CPSQ1
NCBI Protein Information
glutamate decarboxylase 1
UniProt Protein Name
Glutamate decarboxylase 1
Protein Family
UniProt Gene Name
GAD1
UniProt Synonym Gene Names
GAD; GAD67; GAD-67
UniProt Entry Name
DCE1_HUMAN

NCBI Description

This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantigen and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Deficiency in this enzyme has been shown to lead to pyridoxine dependency with seizures. Alternative splicing of this gene results in two products, the predominant 67-kD form and a less-frequent 25-kD form. [provided by RefSeq, Jul 2008]

Uniprot Description

GAD67: Catalyzes the production of GABA. Homodimer. Isoform 3 is expressed in pancreatic islets, testis, adrenal cortex, and perhaps other endocrine tissues, but not in brain. Belongs to the group II decarboxylase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - alanine, aspartate and glutamate; Other Amino Acids Metabolism - taurine and hypotaurine; Other Amino Acids Metabolism - beta-alanine; Carbohydrate Metabolism - butanoate; Lyase; EC 4.1.1.15; Mitochondrial

Chromosomal Location of Human Ortholog: 2q31

Cellular Component: plasma membrane; intracellular; vesicle membrane

Molecular Function: protein binding; glutamate binding; glutamate decarboxylase activity; protein heterodimerization activity; protein N-terminus binding; pyridoxal phosphate binding

Biological Process: response to drug; glutamate catabolic process; synaptic transmission; glutamate decarboxylation to succinate; neurotransmitter secretion; gamma-aminobutyric acid biosynthetic process; protein-pyridoxal-5-phosphate linkage; neurotransmitter biosynthetic process

Disease: Cerebral Palsy, Spastic Quadriplegic, 1

Research Articles on GAD1

Similar Products

Product Notes

The GAD1 gad1 (Catalog #AAA3219725) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GAD1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GAD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GAD1 gad1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CENSDRDARF RRTETDFSNL FARDLLPAKN GEEQTVQFLL EVVDILLNYV. It is sometimes possible for the material contained within the vial of "GAD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual