Rabbit anti-Human GAD1 Polyclonal Antibody | anti-GAD1 antibody

GAD1 Antibody - N-terminal region

Cat. Num. AAA3219725

• Gene Names: GAD1; GAD; SCP; CPSQ1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: GAD1; Polyclonal Antibody; GAD1 Antibody - N-terminal region; anti-GAD1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 16% sucrose.
• Sequence: Synthetic peptide located within the following region: CENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEVVDILLNYV
• Sequence Length: 594

• Applicable Applications for anti-GAD1 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GAD1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GAD1Sample Tissue: 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-GAD1 antibody

This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantigen and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Deficiency in this enzyme has been shown to lead to pyridoxine dependency with seizures. Alternative splicing of this gene results in two products, the predominant 67-kD form and a less-frequent 25-kD form.

Product Categories/Family for anti-GAD1 antibody

Polyclonal; Cell Biology; Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 58331246
• NCBI GeneID: 2571
• NCBI Accession #: NP_000808.2
• NCBI GenBank Nucleotide #: NM_000817.2
• UniProt Accession #: Q99259
• Molecular Weight: 65 kDa
• NCBI Official Full Name: glutamate decarboxylase 1 isoform GAD67
• NCBI Official Synonym Full Names: glutamate decarboxylase 1
• NCBI Official Symbol: GAD1
• NCBI Official Synonym Symbols: GAD; SCP; CPSQ1
• NCBI Protein Information: glutamate decarboxylase 1
• UniProt Protein Name: Glutamate decarboxylase 1
• Protein Family: Glutamate decarboxylase
• UniProt Gene Name: GAD1
• UniProt Synonym Gene Names: GAD; GAD67; GAD-67
• UniProt Entry Name: DCE1_HUMAN

NCBI Description

This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantigen and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Deficiency in this enzyme has been shown to lead to pyridoxine dependency with seizures. Alternative splicing of this gene results in two products, the predominant 67-kD form and a less-frequent 25-kD form. [provided by RefSeq, Jul 2008]

Uniprot Description

GAD67: Catalyzes the production of GABA. Homodimer. Isoform 3 is expressed in pancreatic islets, testis, adrenal cortex, and perhaps other endocrine tissues, but not in brain. Belongs to the group II decarboxylase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - alanine, aspartate and glutamate; Other Amino Acids Metabolism - taurine and hypotaurine; Other Amino Acids Metabolism - beta-alanine; Carbohydrate Metabolism - butanoate; Lyase; EC 4.1.1.15; Mitochondrial

Chromosomal Location of Human Ortholog: 2q31

Cellular Component: plasma membrane; intracellular; vesicle membrane

Molecular Function: protein binding; glutamate binding; glutamate decarboxylase activity; protein heterodimerization activity; protein N-terminus binding; pyridoxal phosphate binding

Biological Process: response to drug; glutamate catabolic process; synaptic transmission; glutamate decarboxylation to succinate; neurotransmitter secretion; gamma-aminobutyric acid biosynthetic process; protein-pyridoxal-5-phosphate linkage; neurotransmitter biosynthetic process

Disease: Cerebral Palsy, Spastic Quadriplegic, 1