Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PDLI7Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human PDLIM7 Polyclonal Antibody | anti-PDLIM7 antibody

PDLIM7 Antibody - middle region

Gene Names
PDLIM7; LMP1; LMP3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PDLIM7; Polyclonal Antibody; PDLIM7 Antibody - middle region; anti-PDLIM7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLTRHSQPATP
Sequence Length
457
Applicable Applications for anti-PDLIM7 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human PDLI7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PDLI7Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PDLI7Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PDLIM7 antibody
This is a rabbit polyclonal antibody against PDLI7. It was validated on Western Blot

Target Description: The protein encoded by this gene is representative of a family of proteins composed of conserved PDZ and LIM domains. LIM domains are proposed to function in protein-protein recognition in a variety of contexts including gene transcription and development and in cytoskeletal interaction. The LIM domains of this protein bind to protein kinases, whereas the PDZ domain binds to actin filaments. The gene product is involved in the assembly of an actin filament-associated complex essential for transmission of ret/ptc2 mitogenic signaling. The biological function is likely to be that of an adapter, with the PDZ domain localizing the LIM-binding proteins to actin filaments of both skeletal muscle and nonmuscle tissues. Alternative splicing of this gene results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
PDZ and LIM domain protein 7
NCBI Official Synonym Full Names
PDZ and LIM domain 7
NCBI Official Symbol
PDLIM7
NCBI Official Synonym Symbols
LMP1; LMP3
NCBI Protein Information
PDZ and LIM domain protein 7
UniProt Protein Name
PDZ and LIM domain protein 7
UniProt Gene Name
PDLIM7
UniProt Synonym Gene Names
ENIGMA; LMP
UniProt Entry Name
PDLI7_HUMAN

NCBI Description

The protein encoded by this gene is representative of a family of proteins composed of conserved PDZ and LIM domains. LIM domains are proposed to function in protein-protein recognition in a variety of contexts including gene transcription and development and in cytoskeletal interaction. The LIM domains of this protein bind to protein kinases, whereas the PDZ domain binds to actin filaments. The gene product is involved in the assembly of an actin filament-associated complex essential for transmission of ret/ptc2 mitogenic signaling. The biological function is likely to be that of an adapter, with the PDZ domain localizing the LIM-binding proteins to actin filaments of both skeletal muscle and nonmuscle tissues. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]

Uniprot Description

PDLIM7: May function as a scaffold on which the coordinated assembly of proteins can occur. May play a role as an adapter that, via its PDZ domain, localizes LIM-binding proteins to actin filaments of both skeletal muscle and nonmuscle tissues. Involved in both of the two fundamental mechanisms of bone formation, direct bone formation e.g (embryonic flat bones mandible and cranium), and endochondral bone formation e.g (embryonic long bone development). Plays a role during fracture repair. Involved in BMP6 signaling pathway. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 5q35.3

Cellular Component: ruffle; focal adhesion; cytoplasm; stress fiber; nucleus; actin cytoskeleton

Molecular Function: protein binding; zinc ion binding

Biological Process: receptor-mediated endocytosis; positive regulation of osteoblast differentiation; ossification; multicellular organismal development; cell differentiation; actin cytoskeleton organization and biogenesis

Research Articles on PDLIM7

Similar Products

Product Notes

The PDLIM7 pdlim7 (Catalog #AAA3219538) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDLIM7 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PDLIM7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDLIM7 pdlim7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSTPQEPWPG PTAPSPTSRP PWAVDPAFAE RYAPDKTSTV LTRHSQPATP. It is sometimes possible for the material contained within the vial of "PDLIM7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.