Western Blot (WB)
(Host: RabbitTarget Name: CT47A12Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human CT47A12 Polyclonal Antibody | anti-CT47A12 antibody
CT47A12 Antibody - C-terminal region
Gene Names
CT47A11; CT47.11
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CT47A12; Polyclonal Antibody; CT47A12 Antibody - C-terminal region; anti-CT47A12 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PTAQEATAPEEVTKSQPEKWDEEAQDAAGEEEKEQEKEKDAENKVKNSKG
Sequence Length
288
Applicable Applications for anti-CT47A12 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CT47A12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: CT47A12Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CT47A12Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CT47A12 antibody
This is a rabbit polyclonal antibody against CT47A12. It was validated on Western Blot
Target Description: This locus represents a member of the cancer/testis gene family 47. This family, also known as CT47, is comprised of 13 nearly identical loci clustered at Xq24.
Target Description: This locus represents a member of the cancer/testis gene family 47. This family, also known as CT47, is comprised of 13 nearly identical loci clustered at Xq24.
Product Categories/Family for anti-CT47A12 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
cancer/testis antigen 47A
NCBI Official Synonym Full Names
cancer/testis antigen family 47 member A11
NCBI Official Symbol
CT47A11
NCBI Official Synonym Symbols
CT47.11
NCBI Protein Information
cancer/testis antigen 47A
UniProt Protein Name
Cancer/testis antigen 47A
UniProt Gene Name
CT47A1
UniProt Synonym Gene Names
CT47.1; CT47
UniProt Entry Name
CT47A_HUMAN
NCBI Description
This locus represents a member of the cancer/testis gene family 47. This family, also known as CT47, is comprised of 13 nearly identical loci clustered at Xq24. [provided by RefSeq, Sep 2010]
Uniprot Description
CT47A:
Protein type: Cancer Testis Antigen (CTA)
Chromosomal Location of Human Ortholog: Xq24
Research Articles on CT47A12
Similar Products
Product Notes
The CT47A12 ct47a1 (Catalog #AAA3219075) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CT47A12 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CT47A12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CT47A12 ct47a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PTAQEATAPE EVTKSQPEKW DEEAQDAAGE EEKEQEKEKD AENKVKNSKG. It is sometimes possible for the material contained within the vial of "CT47A12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
