Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SOHLH2Sample Tissue: Human MDA-MB-435s Whole CellAntibody Dilution: 1ug/ml)

Rabbit SOHLH2 Polyclonal Antibody | anti-SOHLH2 antibody

SOHLH2 Antibody - N-terminal region

Gene Names
SOHLH2; TEB1; SOSF2; SPATA28; bHLHe81
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SOHLH2; Polyclonal Antibody; SOHLH2 Antibody - N-terminal region; anti-SOHLH2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALKLEQESKAYQKINNERRTYLAEMSQGSGLHQVSKRQQVDQLPRMQENL
Sequence Length
502
Applicable Applications for anti-SOHLH2 antibody
Western Blot (WB)
Homology
Dog: 79%; Guinea Pig: 91%; Horse: 79%; Human: 100%; Mouse: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SOHLH2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SOHLH2Sample Tissue: Human MDA-MB-435s Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SOHLH2Sample Tissue: Human MDA-MB-435s Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-SOHLH2 antibody
This is a rabbit polyclonal antibody against SOHLH2. It was validated on Western Blot

Target Description: SOHLH2 is the probable transcription factor, which may be involved in spermatogenesis and oogenesis.
Product Categories/Family for anti-SOHLH2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2 isoform 2
NCBI Official Synonym Full Names
spermatogenesis and oogenesis specific basic helix-loop-helix 2
NCBI Official Symbol
SOHLH2
NCBI Official Synonym Symbols
TEB1; SOSF2; SPATA28; bHLHe81
NCBI Protein Information
spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2
UniProt Protein Name
Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2
UniProt Gene Name
SOHLH2
UniProt Synonym Gene Names
TEB1
UniProt Entry Name
SOLH2_HUMAN

NCBI Description

This gene encodes one of testis-specific transcription factors which are essential for spermatogenesis, oogenesis and folliculogenesis. This gene is located on chromosome 13. The proteins encoded by this gene and another testis-specific transcription factor, SOHLH1, can form heterodimers, in addition to homodimers. There is a read-through locus (GeneID: 100526761) that shares sequence identity with this gene and the upstream CCDC169 (GeneID: 728591). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]

Uniprot Description

SOHLH2: Probable transcription factor, which may be involved in spermatogenesis and oogenesis. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 13q13.3

Cellular Component: nucleus

Molecular Function: protein dimerization activity; DNA binding

Biological Process: oogenesis; transcription, DNA-dependent; regulation of transcription, DNA-dependent; multicellular organismal development; spermatogenesis

Research Articles on SOHLH2

Similar Products

Product Notes

The SOHLH2 sohlh2 (Catalog #AAA3219064) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SOHLH2 Antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SOHLH2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SOHLH2 sohlh2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALKLEQESKA YQKINNERRT YLAEMSQGSG LHQVSKRQQV DQLPRMQENL. It is sometimes possible for the material contained within the vial of "SOHLH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.