Western Blot (WB)
(Host: RabbitTarget Name: MRPL30Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)
Rabbit MRPL30 Polyclonal Antibody | anti-MRPL30 antibody
MRPL30 Antibody - C-terminal region
Gene Names
MRPL30; L28MT; L30MT; MRPL28; RPML28; MRP-L28; MRP-L30; MRPL28M
Reactivity
Dog, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MRPL30; Polyclonal Antibody; MRPL30 Antibody - C-terminal region; anti-MRPL30 antibody
Host
Rabbit
Reactivity
Dog, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VVKHLIRIKPLKLPQGLPAEENMSNTCLKSTGELVVQWHLKPVEQKAHES
Sequence Length
161
Applicable Applications for anti-MRPL30 antibody
Western Blot (WB)
Homology
Dog: 80%; Human: 100%; Mouse: 91%; Rabbit: 89%; Rat: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPL30
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: MRPL30Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: MRPL30Sample Tissue: Human Hela Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-MRPL30 antibody
This is a rabbit polyclonal antibody against MRPL30. It was validated on Western Blot
Target Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Alternative splicing results in multiple transcript variants. Pseudogenes corresponding to this gene are found on chromosomes 6p and 12p. Read-through transcription also exists between this gene and the neighboring upstream lipoyltransferase 1 (LIPT1) gene.
Target Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Alternative splicing results in multiple transcript variants. Pseudogenes corresponding to this gene are found on chromosomes 6p and 12p. Read-through transcription also exists between this gene and the neighboring upstream lipoyltransferase 1 (LIPT1) gene.
Product Categories/Family for anti-MRPL30 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
39S ribosomal protein L30, mitochondrial
NCBI Official Synonym Full Names
mitochondrial ribosomal protein L30
NCBI Official Symbol
MRPL30
NCBI Official Synonym Symbols
L28MT; L30MT; MRPL28; RPML28; MRP-L28; MRP-L30; MRPL28M
NCBI Protein Information
39S ribosomal protein L30, mitochondrial
UniProt Protein Name
39S ribosomal protein L30, mitochondrial
Protein Family
UniProt Gene Name
MRPL30
UniProt Synonym Gene Names
MRPL28; RPML28; HSPC249; L30mt; MRP-L30; L28mt; MRP-L28
UniProt Entry Name
RM30_HUMAN
NCBI Description
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Alternative splicing results in multiple transcript variants. Pseudogenes corresponding to this gene are found on chromosomes 6p and 12p. Read-through transcription also exists between this gene and the neighboring upstream lipoyltransferase 1 (LIPT1) gene. [provided by RefSeq, Mar 2011]
Research Articles on MRPL30
Similar Products
Product Notes
The MRPL30 mrpl30 (Catalog #AAA3218643) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MRPL30 Antibody - C-terminal region reacts with Dog, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MRPL30 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MRPL30 mrpl30 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VVKHLIRIKP LKLPQGLPAE ENMSNTCLKS TGELVVQWHL KPVEQKAHES. It is sometimes possible for the material contained within the vial of "MRPL30, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
