Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SLC25A17Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit SLC25A17 Polyclonal Antibody | anti-SLC25A17 antibody

SLC25A17 Antibody - N-terminal region

Gene Names
SLC25A17; PMP34
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SLC25A17; Polyclonal Antibody; SLC25A17 Antibody - N-terminal region; anti-SLC25A17 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: APYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVAG
Sequence Length
307
Applicable Applications for anti-SLC25A17 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 100%; Rabbit: 86%; Rat: 92%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC25A17
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SLC25A17Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SLC25A17Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SLC25A17 antibody
This is a rabbit polyclonal antibody against SLC25A17. It was validated on Western Blot

Target Description: This gene encodes a peroxisomal membrane protein that belongs to the family of mitochondrial solute carriers. It is expressed in the liver, and is likely involved in transport.
Product Categories/Family for anti-SLC25A17 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
peroxisomal membrane protein PMP34 isoform 1
NCBI Official Synonym Full Names
solute carrier family 25 member 17
NCBI Official Symbol
SLC25A17
NCBI Official Synonym Symbols
PMP34
NCBI Protein Information
peroxisomal membrane protein PMP34
UniProt Protein Name
Peroxisomal membrane protein PMP34
UniProt Gene Name
SLC25A17
UniProt Synonym Gene Names
PMP34
UniProt Entry Name
PM34_HUMAN

NCBI Description

This gene encodes a peroxisomal membrane protein that belongs to the family of mitochondrial solute carriers. It is expressed in the liver, and is likely involved in transport. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]

Uniprot Description

Function: Peroxisomal transporter for multiple cofactors like coenzyme A (CoA), flavin adenine dinucleotide (FAD), flavin mononucleotide (FMN) and nucleotide adenosine monophosphate (AMP), and to a lesser extend for nicotinamide adenine dinucleotide (NAD+), adenosine diphosphate (ADP) and adenosine 3',5'-diphosphate (PAP). May catalyze the transport of free CoA, FAD and NAD+ from the cytosol into the peroxisomal matrix by a counter-exchange mechanism. Inhibited by pyridoxal 5'-phosphate and bathophenanthroline in vitro. Ref.10 Ref.12

Subunit structure: Interacts (via N- and C-terminus peroxisomal targeting regions) with PEX19; the interaction occurs with the newly synthesized SLC25A17 in the cytosol. Ref.7 Ref.9 Ref.11

Subcellular location: Cytoplasm. Peroxisome membrane; Multi-pass membrane protein Ref.8 Ref.9 Ref.11.

Tissue specificity: Ubiquitous. Expressed in liver. Ref.12

Domain: The N- and C-terminal portions are exposed to the cytoplasm. Lacks a typical peroxisomal sorting signal. A region between helical transmembrane domains (TM) 4 and 5 and TM1-TM3 or TM4-TM6 are necessary for the peroxisome-targeting activity.

Sequence similarities: Belongs to the mitochondrial carrier (TC 2.A.29) family. [View classification]Contains 3 Solcar repeats.

Caution: Was first identified as a peroxisomal ATP transporter (Ref.10). However, later experiments showed that it acts as a peroxisomal transporter for multiple cofactors (Ref.12).

Research Articles on SLC25A17

Similar Products

Product Notes

The SLC25A17 slc25a17 (Catalog #AAA3217857) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC25A17 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's SLC25A17 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC25A17 slc25a17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: APYRGWFPVI SSLCCSNFVY FYTFNSLKAL WVKGQHSTTG KDLVVGFVAG. It is sometimes possible for the material contained within the vial of "SLC25A17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.