Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TBATASample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human TBATA Polyclonal Antibody | anti-TBATA antibody

TBATA Antibody - C-terminal region

Gene Names
TBATA; SPATIAL; C10orf27
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TBATA; Polyclonal Antibody; TBATA Antibody - C-terminal region; anti-TBATA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EPPCSQSPKKTKISPFTKSEKPEYIGEAQVLQMHSSQNTEKKTSKPRAES
Sequence Length
351
Applicable Applications for anti-TBATA antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TBATA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TBATASample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TBATASample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TBATA antibody
This is a rabbit polyclonal antibody against TBATA. It was validated on Western Blot

Target Description: TBATA may play a role in spermatid differentiation. It modulates thymic stromal cell proliferation and thymus function.
Product Categories/Family for anti-TBATA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
protein TBATA isoform b
NCBI Official Synonym Full Names
thymus, brain and testes associated
NCBI Official Symbol
TBATA
NCBI Official Synonym Symbols
SPATIAL; C10orf27
NCBI Protein Information
protein TBATA
UniProt Protein Name
Protein SPATIAL
Protein Family
UniProt Gene Name
SPATIAL
UniProt Synonym Gene Names
C10orf27
UniProt Entry Name
SPATL_HUMAN

NCBI Description

This gene encodes a protein that regulates thymic epithelial cell proliferation and thymus size. It has been identified as a ligand for the class I human leukocyte antigen (HLA-I) in thymus. Studies of the orthologous mouse protein suggest that it may also play a role in spermatid differentiation, as well as in neuronal morphogenesis and synaptic plasticity. Polymorphisms in this gene are associated with susceptibility for multiple sclerosis (MS). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]

Uniprot Description

SPATIAL: May play a role in spermatid differentiation. Modulates thymic stromal cell proliferation and thymus function. Belongs to the TBATA family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 10q22.1

Cellular Component: cytosol; nucleus

Biological Process: multicellular organismal development; spermatogenesis; cell differentiation

Research Articles on TBATA

Similar Products

Product Notes

The TBATA spatial (Catalog #AAA3217711) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TBATA Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TBATA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TBATA spatial for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EPPCSQSPKK TKISPFTKSE KPEYIGEAQV LQMHSSQNTE KKTSKPRAES. It is sometimes possible for the material contained within the vial of "TBATA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.