Western Blot (WB)
(Host: RabbitTarget Name: RTN4RL1Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit RTN4RL1 Polyclonal Antibody | anti-RTN4RL1 antibody
RTN4RL1 Antibody - C-terminal region
Gene Names
RTN4RL1; NgR3; NGRH2
Reactivity
Cow, Dog, Horse, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RTN4RL1; Polyclonal Antibody; RTN4RL1 Antibody - C-terminal region; anti-RTN4RL1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPT
Sequence Length
441
Applicable Applications for anti-RTN4RL1 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 79%; Horse: 79%; Human: 100%; Pig: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RTN4RL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: RTN4RL1Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RTN4RL1Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RTN4RL1 antibody
This is a rabbit polyclonal antibody against RTN4RL1. It was validated on Western Blot
Target Description: RTN4RL1 may play a role in regulating axonal regeneration and plasticity in the adult central nervous system.
Target Description: RTN4RL1 may play a role in regulating axonal regeneration and plasticity in the adult central nervous system.
Product Categories/Family for anti-RTN4RL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
reticulon-4 receptor-like 1
NCBI Official Synonym Full Names
reticulon 4 receptor like 1
NCBI Official Symbol
RTN4RL1
NCBI Official Synonym Symbols
NgR3; NGRH2
NCBI Protein Information
reticulon-4 receptor-like 1
UniProt Protein Name
Reticulon-4 receptor-like 1
Protein Family
UniProt Gene Name
RTN4RL1
UniProt Synonym Gene Names
NgR3
UniProt Entry Name
R4RL1_HUMAN
Uniprot Description
RTN4RL1: May play a role in regulating axonal regeneration and plasticity in the adult central nervous system. Belongs to the Nogo receptor family.
Protein type: Membrane protein, integral; Membrane protein, GPI anchor
Chromosomal Location of Human Ortholog: 17p13.3
Cellular Component: cell surface; anchored to plasma membrane; lipid raft; external side of plasma membrane
Molecular Function: receptor activity
Biological Process: axon regeneration
Research Articles on RTN4RL1
Similar Products
Product Notes
The RTN4RL1 rtn4rl1 (Catalog #AAA3217618) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RTN4RL1 Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's RTN4RL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RTN4RL1 rtn4rl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RPGHRKPGKN CTNPRNRNQI SKAGAGKQAP ELPDYAPDYQ HKFSFDIMPT. It is sometimes possible for the material contained within the vial of "RTN4RL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
