Western Blot (WB)
(Host: RabbitTarget Name: KCTD1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit KCTD1 Polyclonal Antibody | anti-KCTD1 antibody
KCTD1 Antibody - middle region
Gene Names
KCTD1; C18orf5
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KCTD1; Polyclonal Antibody; KCTD1 Antibody - middle region; anti-KCTD1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEAKYFQLQPMLLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSG
Sequence Length
257
Applicable Applications for anti-KCTD1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human KCTD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: KCTD1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: KCTD1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-KCTD1 antibody
This is a rabbit polyclonal antibody against KCTD1. It was validated on Western Blot
Target Description: KCTD1 may repress the transcriptional activity of AP-2 family members, including TFAP2A, TFAP2B and TFAP2C to various extent.
Target Description: KCTD1 may repress the transcriptional activity of AP-2 family members, including TFAP2A, TFAP2B and TFAP2C to various extent.
Product Categories/Family for anti-KCTD1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
BTB/POZ domain-containing protein KCTD1 isoform a
NCBI Official Synonym Full Names
potassium channel tetramerization domain containing 1
NCBI Official Symbol
KCTD1
NCBI Official Synonym Symbols
C18orf5
NCBI Protein Information
BTB/POZ domain-containing protein KCTD1
UniProt Protein Name
BTB/POZ domain-containing protein KCTD1
Protein Family
UniProt Gene Name
KCTD1
UniProt Synonym Gene Names
C18orf5
UniProt Entry Name
KCTD1_HUMAN
NCBI Description
This gene encodes a protein containing a BTB (Broad-complex, tramtrack and bric a brac), also known as a POZ (POxvirus and zinc finger) protein-protein interaction domain. The encoded protein negatively regulates the AP-2 family of transcription factors and the Wnt signaling pathway. A mechanism for the modulation of Wnt signaling has been proposed in which the encoded protein enhances ubiquitination and degradation of the beta-catenin protein. Mutations in this gene have been identified in Scalp-ear-nipple (SEN) syndrome. [provided by RefSeq, May 2017]
Research Articles on KCTD1
Similar Products
Product Notes
The KCTD1 kctd1 (Catalog #AAA3217547) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCTD1 Antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KCTD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KCTD1 kctd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEAKYFQLQP MLLEMERWKQ DRETGRFSRP CECLVVRVAP DLGERITLSG. It is sometimes possible for the material contained within the vial of "KCTD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
