Western Blot (WB)
(WB Suggested Anti-GMCL1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellGMCL1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Rabbit GMCL1 Polyclonal Antibody | anti-GMCL1 antibody
GMCL1 Antibody - C-terminal region
Gene Names
GMCL1; GCL; GCL1; BTBD13; SPATA29
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GMCL1; Polyclonal Antibody; GMCL1 Antibody - C-terminal region; anti-GMCL1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QWFAMLRAEQDSEVGPQEINKEELEGNSMRCGRKLAKDGEYCWRWTGFNF
Sequence Length
515
Applicable Applications for anti-GMCL1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GMCL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-GMCL1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellGMCL1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Western Blot (WB)
(WB Suggested Anti-GMCL1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellGMCL1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-GMCL1 antibody
This is a rabbit polyclonal antibody against GMCL1. It was validated on Western Blot
Target Description: This gene encodes a nuclear envelope protein that appears to be involved in spermatogenesis, either directly or by influencing genes that play a more direct role in the process. This multi-exon locus is the homolog of the mouse and drosophila germ cell-less gene but the human genome also contains a single-exon locus on chromosome 5 that contains an open reading frame capable of encoding a highly-related protein.
Target Description: This gene encodes a nuclear envelope protein that appears to be involved in spermatogenesis, either directly or by influencing genes that play a more direct role in the process. This multi-exon locus is the homolog of the mouse and drosophila germ cell-less gene but the human genome also contains a single-exon locus on chromosome 5 that contains an open reading frame capable of encoding a highly-related protein.
Product Categories/Family for anti-GMCL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
germ cell-less protein-like 1
NCBI Official Synonym Full Names
germ cell-less 1, spermatogenesis associated
NCBI Official Symbol
GMCL1
NCBI Official Synonym Symbols
GCL; GCL1; BTBD13; SPATA29
NCBI Protein Information
germ cell-less protein-like 1
UniProt Protein Name
Germ cell-less protein-like 1
Protein Family
UniProt Gene Name
GMCL1
UniProt Synonym Gene Names
GCL
UniProt Entry Name
GMCL1_HUMAN
NCBI Description
This gene encodes a nuclear envelope protein that appears to be involved in spermatogenesis, either directly or by influencing genes that play a more direct role in the process. This multi-exon locus is the homolog of the mouse and drosophila germ cell-less gene but the human genome also contains a single-exon locus on chromosome 5 that contains an open reading frame capable of encoding a highly-related protein. [provided by RefSeq, Jul 2008]
Research Articles on GMCL1
Similar Products
Product Notes
The GMCL1 gmcl1 (Catalog #AAA3217347) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GMCL1 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GMCL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GMCL1 gmcl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QWFAMLRAEQ DSEVGPQEIN KEELEGNSMR CGRKLAKDGE YCWRWTGFNF. It is sometimes possible for the material contained within the vial of "GMCL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
