Western Blot (WB)
(WB Suggested Anti-C9orf24 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole cell)
Rabbit C9orf24 Polyclonal Antibody | anti-C9ORF24 antibody
C9orf24 Antibody - N-terminal region
Gene Names
C9orf24; CBE1; SMRP1; NYD-SP22; bA573M23.4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C9orf24; Polyclonal Antibody; C9orf24 Antibody - N-terminal region; anti-C9ORF24 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MFLFSRKTRTPISTYSDSYRAPTSIKEVYKDPPLCAWEANKFLTPGLTHT
Sequence Length
262
Applicable Applications for anti-C9ORF24 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human C9orf24
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-C9orf24 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole cell)
Western Blot (WB)
(WB Suggested Anti-C9orf24 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole cell)
Related Product Information for anti-C9ORF24 antibody
This is a rabbit polyclonal antibody against C9orf24. It was validated on Western Blot
Target Description: This gene encodes a nuclear- or perinuclear-localized protein with no predicted domains or similarity to other known proteins. Expression of this gene is induced during the differentiation of bronchial epithelial cells, and the encoded protein may play a role in ciliogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Target Description: This gene encodes a nuclear- or perinuclear-localized protein with no predicted domains or similarity to other known proteins. Expression of this gene is induced during the differentiation of bronchial epithelial cells, and the encoded protein may play a role in ciliogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for anti-C9ORF24 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
spermatid-specific manchette-related protein 1 isoform 1
NCBI Official Synonym Full Names
chromosome 9 open reading frame 24
NCBI Official Symbol
C9orf24
NCBI Official Synonym Symbols
CBE1; SMRP1; NYD-SP22; bA573M23.4
NCBI Protein Information
spermatid-specific manchette-related protein 1
UniProt Protein Name
Spermatid-specific manchette-related protein 1
UniProt Gene Name
SMRP1
UniProt Synonym Gene Names
C9orf24; CBE1
UniProt Entry Name
SMRP1_HUMAN
NCBI Description
This gene encodes a nuclear- or perinuclear-localized protein with no predicted domains or similarity to other known proteins. Expression of this gene is induced during the differentiation of bronchial epithelial cells, and the encoded protein may play a role in ciliogenesis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Nov 2011]
Research Articles on C9ORF24
Similar Products
Product Notes
The C9ORF24 smrp1 (Catalog #AAA3217327) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C9orf24 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C9orf24 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the C9ORF24 smrp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MFLFSRKTRT PISTYSDSYR APTSIKEVYK DPPLCAWEAN KFLTPGLTHT. It is sometimes possible for the material contained within the vial of "C9orf24, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
