Western Blot (WB)
(WB Suggested Anti-OLFM1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)
Rabbit OLFM1 Polyclonal Antibody | anti-OLFM1 antibody
OLFM1 Antibody - C-terminal region
Gene Names
OLFM1; AMY; NOE1; OlfA; NOELIN1
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OLFM1; Polyclonal Antibody; OLFM1 Antibody - C-terminal region; anti-OLFM1 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EKVQNMSQSIEVLDRRTQRDLQYVEKMENQMKGLESKFKQVEESHKQHLA
Sequence Length
135
Applicable Applications for anti-OLFM1 antibody
Western Blot (WB)
Homology
Cow: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human OLFM1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-OLFM1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)
Western Blot (WB)
(WB Suggested Anti-OLFM1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)
Related Product Information for anti-OLFM1 antibody
This is a rabbit polyclonal antibody against OLFM1. It was validated on Western Blot
Target Description: This gene product shares extensive sequence similarity with the rat neuronal olfactomedin-related ER localized protein. While the exact function of the encoded protein is not known, its abundant expression in brain suggests that it may have an essential role in nerve tissue. Several alternatively spliced transcripts encoding different isoforms have been found for this gene.
Target Description: This gene product shares extensive sequence similarity with the rat neuronal olfactomedin-related ER localized protein. While the exact function of the encoded protein is not known, its abundant expression in brain suggests that it may have an essential role in nerve tissue. Several alternatively spliced transcripts encoding different isoforms have been found for this gene.
Product Categories/Family for anti-OLFM1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
10kDa
NCBI Official Full Name
noelin isoform 2
NCBI Official Synonym Full Names
olfactomedin 1
NCBI Official Symbol
OLFM1
NCBI Official Synonym Symbols
AMY; NOE1; OlfA; NOELIN1
NCBI Protein Information
noelin
UniProt Protein Name
NOELIN1_V4
Protein Family
UniProt Gene Name
OLFM1
UniProt Entry Name
Q6IMJ7_HUMAN
NCBI Description
This gene product shares extensive sequence similarity with the rat neuronal olfactomedin-related ER localized protein. While the exact function of the encoded protein is not known, its abundant expression in brain suggests that it may have an essential role in nerve tissue. Several alternatively spliced transcripts encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Description
OLFM1: Seems to play an important role in regulating the production of neural crest cells by the neural tube. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Cell adhesion; Cell development/differentiation
Chromosomal Location of Human Ortholog: 9q34.3
Cellular Component: extracellular space; synapse; cell junction
Molecular Function: protein binding; beta-amyloid binding
Biological Process: nervous system development; protein oligomerization
Research Articles on OLFM1
Similar Products
Product Notes
The OLFM1 olfm1 (Catalog #AAA3217034) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OLFM1 Antibody - C-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's OLFM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OLFM1 olfm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EKVQNMSQSI EVLDRRTQRD LQYVEKMENQ MKGLESKFKQ VEESHKQHLA. It is sometimes possible for the material contained within the vial of "OLFM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
