Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-P2RY14 AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole CellP2RY14 is supported by BioGPS gene expression data to be expressed in MDA-MB435)

Rabbit P2RY14 Polyclonal Antibody | anti-P2RY14 antibody

P2RY14 Antibody - C-terminal region

Gene Names
P2RY14; P2Y14; BPR105; GPR105
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
P2RY14; Polyclonal Antibody; P2RY14 Antibody - C-terminal region; anti-P2RY14 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQPFREI
Sequence Length
338
Applicable Applications for anti-P2RY14 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 79%; Pig: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human P2RY14
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-P2RY14 AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole CellP2RY14 is supported by BioGPS gene expression data to be expressed in MDA-MB435)

Western Blot (WB) (WB Suggested Anti-P2RY14 AntibodyTitration: 1.0 ug/mlPositive Control: MDA-MB-435S Whole CellP2RY14 is supported by BioGPS gene expression data to be expressed in MDA-MB435)
Related Product Information for anti-P2RY14 antibody
This is a rabbit polyclonal antibody against P2RY14. It was validated on Western Blot

Target Description: The product of this gene belongs to the family of G-protein coupled receptors, which contains several receptor subtypes with different pharmacological selectivity for various adenosine and uridine nucleotides. This receptor is a P2Y purinergic receptor for UDP-glucose and other UDP-sugars coupled to G-proteins. It has been implicated in extending the known immune system functions of P2Y receptors by participating in the regulation of the stem cell compartment, and it may also play a role in neuroimmune function. Two transcript variants encoding the same protein have been identified for this gene.
Product Categories/Family for anti-P2RY14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
P2Y purinoceptor 14
NCBI Official Synonym Full Names
purinergic receptor P2Y14
NCBI Official Symbol
P2RY14
NCBI Official Synonym Symbols
P2Y14; BPR105; GPR105
NCBI Protein Information
P2Y purinoceptor 14
UniProt Protein Name
P2Y purinoceptor 14
Protein Family
UniProt Gene Name
P2RY14
UniProt Synonym Gene Names
GPR105; KIAA0001; P2Y14
UniProt Entry Name
P2Y14_HUMAN

NCBI Description

The product of this gene belongs to the family of G-protein coupled receptors, which contains several receptor subtypes with different pharmacological selectivity for various adenosine and uridine nucleotides. This receptor is a P2Y purinergic receptor for UDP-glucose and other UDP-sugars coupled to G-proteins. It has been implicated in extending the known immune system functions of P2Y receptors by participating in the regulation of the stem cell compartment, and it may also play a role in neuroimmune function. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

P2RY14: Receptor for UDP-glucose and other UDP-sugar coupled to G-proteins. Not activated by ATP, ADP, UTP or ATP. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 3q24-q25.1

Cellular Component: integral to plasma membrane; integral to membrane; plasma membrane

Molecular Function: UDP-activated nucleotide receptor activity; purinergic nucleotide receptor activity, G-protein coupled

Biological Process: G-protein coupled receptor protein signaling pathway

Research Articles on P2RY14

Similar Products

Product Notes

The P2RY14 p2ry14 (Catalog #AAA3216687) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The P2RY14 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's P2RY14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the P2RY14 p2ry14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YTKSQTEAHY SCQSKEILRY MKEFTLLLSA ANVCLDPIIY FFLCQPFREI. It is sometimes possible for the material contained within the vial of "P2RY14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.