Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HTRA3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Rabbit HTRA3 Polyclonal Antibody | anti-HTRA3 antibody

HTRA3 antibody - middle region

Gene Names
HTRA3; Prsp; Tasp
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HTRA3; Polyclonal Antibody; HTRA3 antibody - middle region; anti-HTRA3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TNAHVVSSNSAAPGRQQLKVQLQNGDSYEATIKDIDKKSDIATIKIHPKK
Sequence Length
453
Applicable Applications for anti-HTRA3 antibody
Western Blot (WB)
Homology
Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 86%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HTRA3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Western Blot (WB) (WB Suggested Anti-HTRA3 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Related Product Information for anti-HTRA3 antibody
This is a rabbit polyclonal antibody against HTRA3. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-HTRA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
serine protease HTRA3 isoform 1
NCBI Official Synonym Full Names
HtrA serine peptidase 3
NCBI Official Symbol
HTRA3
NCBI Official Synonym Symbols
Prsp; Tasp
NCBI Protein Information
serine protease HTRA3
UniProt Protein Name
Serine protease HTRA3
Protein Family
UniProt Gene Name
HTRA3
UniProt Synonym Gene Names
PRSP
UniProt Entry Name
HTRA3_HUMAN

Uniprot Description

HTRA3: Serine protease that cleaves beta-casein/CSN2 as well as several extracellular matrix (ECM) proteoglycans such as decorin/DCN, biglycan/BGN and fibronectin/FN1. Inhibits signaling mediated by TGF-beta family proteins possibly indirectly by degradation of these ECM proteoglycans. May act as a tumor suppressor. Negatively regulates, in vitro, trophoblast invasion during placental development and may be involved in the development of the placenta in vivo. May also have a role in ovarian development, granulosa cell differentiation and luteinization. Belongs to the peptidase S1B family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.21.-; Secreted, signal peptide; Protease; Secreted

Chromosomal Location of Human Ortholog: 4p16.1

Cellular Component: extracellular region

Molecular Function: insulin-like growth factor binding; protein binding; serine-type peptidase activity; serine-type endopeptidase activity; endopeptidase activity

Biological Process: regulation of cell growth; negative regulation of transforming growth factor beta receptor signaling pathway; proteolysis; negative regulation of BMP signaling pathway

Research Articles on HTRA3

Similar Products

Product Notes

The HTRA3 htra3 (Catalog #AAA3216465) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HTRA3 antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HTRA3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HTRA3 htra3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TNAHVVSSNS AAPGRQQLKV QLQNGDSYEA TIKDIDKKSD IATIKIHPKK. It is sometimes possible for the material contained within the vial of "HTRA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.