Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PROK2 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole Cell)

Rabbit PROK2 Polyclonal Antibody | anti-PROK2 antibody

PROK2 antibody - middle region

Gene Names
PROK2; BV8; HH4; PK2; KAL4; MIT1
Reactivity
Cow, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PROK2; Polyclonal Antibody; PROK2 antibody - middle region; anti-PROK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRR
Sequence Length
129
Applicable Applications for anti-PROK2 antibody
Western Blot (WB)
Homology
Cow: 85%; Human: 100%; Mouse: 79%; Pig: 86%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PROK2 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole Cell)

Western Blot (WB) (WB Suggested Anti-PROK2 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole Cell)
Related Product Information for anti-PROK2 antibody
This is a rabbit polyclonal antibody against PROK2. It was validated on Western Blot

Target Description: This gene encodes a protein expressed in the suprachiasmatic nucleus (SCN) circadian clock that may function as the output component of the circadian clock. The secreted form of the encoded protein may also serve as a chemoattractant for neuronal precursor cells in the olfactory bulb. Proteins from other vertebrates which are similar to this gene product were isolated based on homology to snake venom and secretions from frog skin, and have been shown to have diverse functions.
Product Categories/Family for anti-PROK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
prokineticin-2 isoform a
NCBI Official Synonym Full Names
prokineticin 2
NCBI Official Symbol
PROK2
NCBI Official Synonym Symbols
BV8; HH4; PK2; KAL4; MIT1
NCBI Protein Information
prokineticin-2
UniProt Protein Name
Prokineticin-2
Protein Family
UniProt Gene Name
PROK2
UniProt Synonym Gene Names
BV8; PK2
UniProt Entry Name
PROK2_HUMAN

NCBI Description

This gene encodes a protein expressed in the suprachiasmatic nucleus (SCN) circadian clock that may function as the output component of the circadian clock. The secreted form of the encoded protein may also serve as a chemoattractant for neuronal precursor cells in the olfactory bulb. Proteins from other vertebrates which are similar to this gene product were isolated based on homology to snake venom and secretions from frog skin, and have been shown to have diverse functions. Mutations in this gene are associated with Kallmann syndrome 4. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

PROK2: May function as an output molecule from the suprachiasmatic nucleus (SCN) that transmits behavioral circadian rhythm. May also function locally within the SCN to synchronize output. Potently contracts gastrointestinal (GI) smooth muscle. Defects in PROK2 are the cause of Kallmann syndrome type 4 (KAL4); also known as hypogonadotropic hypogonadism and anosmia. Anosmia or hyposmia is related to the absence or hypoplasia of the olfactory bulbs and tracts. Hypogonadism is due to deficiency in gonadotropin-releasing hormone and probably results from a failure of embryonic migration of gonadotropin- releasing hormone-synthesizing neurons. KAL4 patients have variable degrees of olfactory and reproductive dysfunction, but do not show any of the occasional clinical anomalies reported in Kallmann syndrome such as renal agenesis, cleft lip/palate, selective tooth agenesis, and bimanual synkinesis. Belongs to the AVIT (prokineticin) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 3p13

Cellular Component: extracellular region

Molecular Function: G-protein-coupled receptor binding

Biological Process: circadian rhythm; activation of MAPK activity; sensory perception of pain; chemotaxis; cell proliferation; G-protein coupled receptor protein signaling pathway; elevation of cytosolic calcium ion concentration; neuropeptide signaling pathway; spermatogenesis; positive regulation of smooth muscle contraction; angiogenesis; inflammatory response; negative regulation of apoptosis

Disease: Hypogonadotropic Hypogonadism 4 With Or Without Anosmia

Research Articles on PROK2

Similar Products

Product Notes

The PROK2 prok2 (Catalog #AAA3216161) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PROK2 antibody - middle region reacts with Cow, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PROK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PROK2 prok2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KSIRICTPMG KLGDSCHPLT RKNNFGNGRQ ERRKRKRSKR KKEVPFFGRR. It is sometimes possible for the material contained within the vial of "PROK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.