Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CYP4F2 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellCYP4F2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Rabbit CYP4F2 Polyclonal Antibody | anti-CYP4F2 antibody

CYP4F2 antibody - C-terminal region

Gene Names
CYP4F2; CPF2
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CYP4F2; Polyclonal Antibody; CYP4F2 antibody - C-terminal region; anti-CYP4F2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGL
Sequence Length
520
Applicable Applications for anti-CYP4F2 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 86%; Goat: 83%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CYP4F2 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellCYP4F2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Western Blot (WB) (WB Suggested Anti-CYP4F2 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellCYP4F2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
Related Product Information for anti-CYP4F2 antibody
This is a rabbit polyclonal antibody against CYP4F2. It was validated on Western Blot

Target Description: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. The enzyme starts the process of inactivating and degrading leukotriene B4, a potent mediator of inflammation. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Another member of this family, CYP4F11, is approximately 16 kb away.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
phylloquinone omega-hydroxylase CYP4F2
NCBI Official Synonym Full Names
cytochrome P450 family 4 subfamily F member 2
NCBI Official Symbol
CYP4F2
NCBI Official Synonym Symbols
CPF2
NCBI Protein Information
phylloquinone omega-hydroxylase CYP4F2
UniProt Protein Name
Phylloquinone omega-hydroxylase CYP4F2
UniProt Gene Name
CYP4F2
UniProt Entry Name
CP4F2_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. The enzyme starts the process of inactivating and degrading leukotriene B4, a potent mediator of inflammation. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Another member of this family, CYP4F11, is approximately 16 kb away. [provided by RefSeq, Jul 2008]

Uniprot Description

CYP4F2: Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Belongs to the cytochrome P450 family.

Protein type: EC 1.14.13.30; EC 1.14.13.194; Oxidoreductase; Lipid Metabolism - arachidonic acid

Chromosomal Location of Human Ortholog: 19p13.12

Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle; apical plasma membrane; cytoplasm

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NADH or NADPH as one donor, and incorporation of one atom of oxygen; leukotriene-B4 20-monooxygenase activity; protein binding; iron ion binding; heme binding; arachidonic acid epoxygenase activity; vitamin-K-epoxide reductase (warfarin-sensitive) activity; alkane 1-monooxygenase activity

Biological Process: negative regulation of icosanoid secretion; icosanoid metabolic process; negative regulation of blood coagulation; vitamin K catabolic process; leukotriene metabolic process; epoxygenase P450 pathway; long-chain fatty acid metabolic process; phylloquinone catabolic process; vitamin E metabolic process; vitamin K biosynthetic process; very-long-chain fatty acid metabolic process; menaquinone catabolic process; xenobiotic metabolic process; regulation of blood pressure; positive regulation of icosanoid secretion; arachidonic acid metabolic process; renal water homeostasis; sodium ion homeostasis; drug metabolic process; blood coagulation; pressure natriuresis

Research Articles on CYP4F2

Similar Products

Product Notes

The CYP4F2 cyp4f2 (Catalog #AAA3216146) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP4F2 antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CYP4F2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CYP4F2 cyp4f2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QAKAKSKTLD FIDVLLLSKD EDGKKLSDED IRAEADTFMF EGHDTTASGL. It is sometimes possible for the material contained within the vial of "CYP4F2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.