Western Blot (WB)
(WB Suggested Anti-MTFR1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)
Rabbit MTFR1 Polyclonal Antibody | anti-MTFR1 antibody
MTFR1 antibody - C-terminal region
Gene Names
PNO1; RRP20; KHRBP1
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MTFR1; Polyclonal Antibody; MTFR1 antibody - C-terminal region; anti-MTFR1 antibody
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LGLHQSTSAVDLIKERREKRANAGKTLVKNNPKKPEMPNMLEILKEMNSV
Sequence Length
300
Applicable Applications for anti-MTFR1 antibody
Western Blot (WB)
Homology
Dog: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Pig: 79%; Rabbit: 86%; Rat: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-MTFR1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)
Western Blot (WB)
(WB Suggested Anti-MTFR1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Liver)
Related Product Information for anti-MTFR1 antibody
This is a rabbit polyclonal antibody against MTFR1. It was validated on Western Blot
Target Description: This gene encodes a mitochondrial protein that is characterized by a poly-proline rich region. A chicken homolog of this protein promotes mitochondrial fission and the mouse homolog protects cells from oxidative stress. A related pseudogene of this gene is found on chromosome X.
Target Description: This gene encodes a mitochondrial protein that is characterized by a poly-proline rich region. A chicken homolog of this protein promotes mitochondrial fission and the mouse homolog protects cells from oxidative stress. A related pseudogene of this gene is found on chromosome X.
Product Categories/Family for anti-MTFR1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
RNA-binding protein PNO1 isoform 1
NCBI Official Synonym Full Names
partner of NOB1 homolog
NCBI Official Symbol
PNO1
NCBI Official Synonym Symbols
RRP20; KHRBP1
NCBI Protein Information
RNA-binding protein PNO1
UniProt Protein Name
RNA-binding protein PNO1
Protein Family
UniProt Gene Name
PNO1
UniProt Entry Name
PNO1_HUMAN
Research Articles on MTFR1
Similar Products
Product Notes
The MTFR1 pno1 (Catalog #AAA3215670) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MTFR1 antibody - C-terminal region reacts with Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MTFR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MTFR1 pno1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGLHQSTSAV DLIKERREKR ANAGKTLVKN NPKKPEMPNM LEILKEMNSV. It is sometimes possible for the material contained within the vial of "MTFR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
