Western Blot (WB)
(Host: RabbitTarget Name: COL21A1Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)
Rabbit COL21A1 Polyclonal Antibody | anti-COL21A1 antibody
COL21A1 Antibody - C-terminal region
Gene Names
COL21A1; FP633; COLA1L
Reactivity
Dog, Horse, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
COL21A1; Polyclonal Antibody; COL21A1 Antibody - C-terminal region; anti-COL21A1 antibody
Host
Rabbit
Reactivity
Dog, Horse, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PGEPGYMGLPGIQGKKGDKGNQGEKGIQGQKGENGRQGIPGQQGIQGHHG
Sequence Length
323
Applicable Applications for anti-COL21A1 antibody
Western Blot (WB)
Homology
Dog: 93%; Horse: 100%; Human: 100%; Pig: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human COL21A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: COL21A1Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: COL21A1Sample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-COL21A1 antibody
This is a rabbit polyclonal antibody against COL21A1. It was validated on Western Blot
Target Description: This gene encodes the alpha chain of type XXI collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Type XXI collagen is localized to tissues containing type I collagen so, like other members of this collagen family, it may serve to maintain the integrity of the extracellular matrix. An alternatively spliced transcript variant has been described, but its full-length nature has yet to be determined.
Target Description: This gene encodes the alpha chain of type XXI collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Type XXI collagen is localized to tissues containing type I collagen so, like other members of this collagen family, it may serve to maintain the integrity of the extracellular matrix. An alternatively spliced transcript variant has been described, but its full-length nature has yet to be determined.
Product Categories/Family for anti-COL21A1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
collagen alpha-1(XXI) chain isoform a
NCBI Official Synonym Full Names
collagen type XXI alpha 1 chain
NCBI Official Symbol
COL21A1
NCBI Official Synonym Symbols
FP633; COLA1L
NCBI Protein Information
collagen alpha-1(XXI) chain
UniProt Protein Name
Collagen alpha-1(XXI) chain
Protein Family
UniProt Gene Name
COL21A1
UniProt Synonym Gene Names
COL1AL; FP633
UniProt Entry Name
COLA1_HUMAN
NCBI Description
This gene encodes the alpha chain of type XXI collagen, a member of the FACIT (fibril-associated collagens with interrupted helices) collagen family. Type XXI collagen is localized to tissues containing type I collagen and maintains the integrity of the extracellular matrix. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Research Articles on COL21A1
Similar Products
Product Notes
The COL21A1 col21a1 (Catalog #AAA3215600) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The COL21A1 Antibody - C-terminal region reacts with Dog, Horse, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's COL21A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the COL21A1 col21a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGEPGYMGLP GIQGKKGDKG NQGEKGIQGQ KGENGRQGIP GQQGIQGHHG. It is sometimes possible for the material contained within the vial of "COL21A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
