Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NUDT6 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Rabbit NUDT6 Polyclonal Antibody | anti-NUDT6 antibody

NUDT6 antibody - middle region

Gene Names
NUDT6; GFG1; GFG-1; ASFGF2; FGF-AS; FGF2AS
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NUDT6; Polyclonal Antibody; NUDT6 antibody - middle region; anti-NUDT6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASLGFCFHHAESDSSTLTLWLREGPSRLPGYASHQVGVAGAVFDESTRKI
Sequence Length
316
Applicable Applications for anti-NUDT6 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 100%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NUDT6 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)

Western Blot (WB) (WB Suggested Anti-NUDT6 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Related Product Information for anti-NUDT6 antibody
This is a rabbit polyclonal antibody against NUDT6. It was validated on Western Blot

Target Description: FGF2 (MIM 134920) is a highly conserved, multifunctional heparin-binding growth factor involved in neuroectoderm development, angiogenesis, and wound healing. Elevated levels of FGF2 are associated with proliferation of smooth muscle in atherosclerosis and with proliferation of tumors. The FGF2 antisense gene, NUDT6, may regulate FGF2 expression.
Product Categories/Family for anti-NUDT6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
nucleoside diphosphate-linked moiety X motif 6 isoform a
NCBI Official Synonym Full Names
nudix hydrolase 6
NCBI Official Symbol
NUDT6
NCBI Official Synonym Symbols
GFG1; GFG-1; ASFGF2; FGF-AS; FGF2AS
NCBI Protein Information
nucleoside diphosphate-linked moiety X motif 6
UniProt Protein Name
Nucleoside diphosphate-linked moiety X motif 6
Protein Family
UniProt Gene Name
NUDT6
UniProt Synonym Gene Names
FGF2AS; Nudix motif 6
UniProt Entry Name
NUDT6_HUMAN

NCBI Description

This gene overlaps and lies on the opposite strand from FGF2 gene, and is thought to be the FGF2 antisense gene. The two genes are independently transcribed, and their expression shows an inverse relationship, suggesting that this antisense transcript may regulate FGF2 expression. This gene has also been shown to have hormone-regulatory and antiproliferative actions in the pituitary that are independent of FGF2 expression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

NUDT6: May contribute to the regulation of cell proliferation. Belongs to the Nudix hydrolase family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 4q26

Cellular Component: mitochondrion; nucleus

Molecular Function: growth factor activity; hydrolase activity

Biological Process: metabolic process

Research Articles on NUDT6

Similar Products

Product Notes

The NUDT6 nudt6 (Catalog #AAA3215460) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NUDT6 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NUDT6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NUDT6 nudt6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASLGFCFHHA ESDSSTLTLW LREGPSRLPG YASHQVGVAG AVFDESTRKI. It is sometimes possible for the material contained within the vial of "NUDT6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.