Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RPP21 AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)

Rabbit RPP21 Polyclonal Antibody | anti-RPP21 antibody

RPP21 antibody - middle region

Gene Names
CARD10; BIMP1; CARMA3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RPP21; Polyclonal Antibody; RPP21 antibody - middle region; anti-RPP21 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LVPGLTCTQRQRRCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQL
Sequence Length
144
Applicable Applications for anti-RPP21 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RPP21 AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)

Western Blot (WB) (WB Suggested Anti-RPP21 AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)
Related Product Information for anti-RPP21 antibody
This is a rabbit polyclonal antibody against RPP21. It was validated on Western Blot

Target Description: RPP21 is a protein subunit of nuclear ribonuclease P, which processes the 5-prime leader sequence of precursor tRNAs.
Product Categories/Family for anti-RPP21 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa
NCBI Official Full Name
caspase recruitment domain-containing protein 10
NCBI Official Synonym Full Names
caspase recruitment domain family member 10
NCBI Official Symbol
CARD10
NCBI Official Synonym Symbols
BIMP1; CARMA3
NCBI Protein Information
caspase recruitment domain-containing protein 10
UniProt Protein Name
Caspase recruitment domain-containing protein 10
Protein Family
UniProt Gene Name
CARD10
UniProt Synonym Gene Names
CARMA3; Carma 3
UniProt Entry Name
CAR10_HUMAN

NCBI Description

The caspase recruitment domain (CARD) is a protein module that consists of 6 or 7 antiparallel alpha helices. It participates in apoptosis signaling through highly specific protein-protein homophilic interactions. Like several other CARD proteins, CARD10 belongs to the membrane-associated guanylate kinase (MAGUK) family and activates NF-kappa-B (NFKB; see MIM 164011) through BCL10 (MIM 603517) (Wang et al., 2001 [PubMed 11259443]).[supplied by OMIM, Mar 2008]

Uniprot Description

CARD10: a protein containing a caspase recruitment domain (CARD) that functions as an activator of BCL10 and NF-kappaB signaling. CARD is a protein module that consists of 6 or 7 antiparallel alpha helices. It participates in apoptosis signaling through highly specific protein-protein homophilic interactions. CARD proteins function as scaffolds for the assembly of multiprotein complexes at specialized regions of the plasma membrane. The CARD domain of CARD14 associates specifically with the CARD domains of CARD10 and BCL10, a signaling protein that activates NF-kB through the IkappaB kinase complex in response to upstream stimuli. When expressed in cells, CARD14 activates NF-kappaB and induces the phosphorylation of BCL10. A subgroup of primary lymphomas of the central nervous system have higher levels of CARD14 expression.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: CBM complex; cytoplasm

Molecular Function: protein binding; receptor signaling complex scaffold activity

Biological Process: regulation of apoptosis; activation of NF-kappaB-inducing kinase; protein complex assembly

Research Articles on RPP21

Similar Products

Product Notes

The RPP21 card10 (Catalog #AAA3215369) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPP21 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RPP21 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RPP21 card10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVPGLTCTQR QRRCRGQRWT VQTCLTCQRS QRFLNDPGHL LWGDRPEAQL. It is sometimes possible for the material contained within the vial of "RPP21, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.