Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Lanes:Lane 1: 20ug A549 cell lysateLane 2: 20ug H1437 cell lysateLane 3: 20ug PC3 cell lysatePrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Gene Name:EFNA4Submitted by:Erika Mathes Lisabeth, Sanford-Burnham Medical Research Institute)

Rabbit anti-Human, Pig EFNA4 Polyclonal Antibody | anti-EFNA4 antibody

EFNA4 antibody - N-terminal region

Gene Names
EFNA4; EFL4; EPLG4; LERK4
Reactivity
Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EFNA4; Polyclonal Antibody; EFNA4 antibody - N-terminal region; anti-EFNA4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKI
Sequence Length
214
Applicable Applications for anti-EFNA4 antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 79%
Conjugation
Unconjugated
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Lanes:Lane 1: 20ug A549 cell lysateLane 2: 20ug H1437 cell lysateLane 3: 20ug PC3 cell lysatePrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Gene Name:EFNA4Submitted by:Erika Mathes Lisabeth, Sanford-Burnham Medical Research Institute)

Western Blot (WB) (Lanes:Lane 1: 20ug A549 cell lysateLane 2: 20ug H1437 cell lysateLane 3: 20ug PC3 cell lysatePrimary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:1000Gene Name:EFNA4Submitted by:Erika Mathes Lisabeth, Sanford-Burnham Medical Research Institute)

Western Blot (WB)

(WB Suggested Anti-EFNA4 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellEFNA4 is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (WB Suggested Anti-EFNA4 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellEFNA4 is supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-EFNA4 antibody
This is a rabbit polyclonal antibody against EFNA4. It was validated on Western Blot

Target Description: This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. Three transcript variants that encode distinct proteins have been identified.
Product Categories/Family for anti-EFNA4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
ephrin-A4 isoform c
NCBI Official Synonym Full Names
ephrin A4
NCBI Official Symbol
EFNA4
NCBI Official Synonym Symbols
EFL4; EPLG4; LERK4
NCBI Protein Information
ephrin-A4
UniProt Protein Name
Ephrin-A4
Protein Family
UniProt Gene Name
EFNA4
UniProt Synonym Gene Names
EPLG4; LERK4; LERK-4
UniProt Entry Name
EFNA4_HUMAN

NCBI Description

This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. Three transcript variants that encode distinct proteins have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

EFNA4: Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. May play a role in the interaction between activated B-lymphocytes and dendritic cells in tonsils. Belongs to the ephrin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, GPI anchor; Ligand, receptor tyrosine kinase

Chromosomal Location of Human Ortholog: 1q21-q22

Cellular Component: integral to plasma membrane; plasma membrane; extracellular region

Molecular Function: protein binding; transmembrane-ephrin receptor activity; ephrin receptor binding

Biological Process: axon guidance; cell-cell signaling; ephrin receptor signaling pathway; osteoclast differentiation; bone remodeling

Research Articles on EFNA4

Similar Products

Product Notes

The EFNA4 efna4 (Catalog #AAA3215279) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EFNA4 antibody - N-terminal region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's EFNA4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EFNA4 efna4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GPGPPEGPET FALYMVDWPG YESCQAEGPR AYKRWVCSLP FGHVQFSEKI. It is sometimes possible for the material contained within the vial of "EFNA4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.