Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GP9 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)

Rabbit GP9 Polyclonal Antibody | anti-GP9 antibody

GP9 antibody - middle region

Gene Names
GP9; GPIX; CD42a
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GP9; Polyclonal Antibody; GP9 antibody - middle region; anti-GP9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NSLQSVPPGAFDHLPQLQTLDVTQNPWHCDCSLTYLRLWLEDRTPEALLQ
Sequence Length
177
Applicable Applications for anti-GP9 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 93%; Human: 100%; Mouse: 86%; Pig: 83%; Rabbit: 86%; Rat: 86%; Yeast: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GP9 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)

Western Blot (WB) (WB Suggested Anti-GP9 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)
Related Product Information for anti-GP9 antibody
This is a rabbit polyclonal antibody against GP9. It was validated on Western Blot

Target Description: This gene encodes a small membrane glycoprotein found on the surface of human platelets. It forms a 1-to-1 noncovalent complex with glycoprotein Ib, a platelet surface membrane glycoprotein complex that functions as a receptor for von Willebrand factor. The complete receptor complex includes noncovalent association of the alpha and beta subunits with the protein encoded by this gene and platelet glycoprotein V. Defects in this gene are a cause of Bernard-Soulier syndrome, also known as giant platelet disease. These patients have unusually large platelets and have a clinical bleeding tendency.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
platelet glycoprotein IX
NCBI Official Synonym Full Names
glycoprotein IX platelet
NCBI Official Symbol
GP9
NCBI Official Synonym Symbols
GPIX; CD42a
NCBI Protein Information
platelet glycoprotein IX
UniProt Protein Name
Platelet glycoprotein IX
Protein Family
UniProt Gene Name
GP9
UniProt Synonym Gene Names
GP-IX; GPIX

NCBI Description

This gene encodes a small membrane glycoprotein found on the surface of human platelets. It forms a 1-to-1 noncovalent complex with glycoprotein Ib, a platelet surface membrane glycoprotein complex that functions as a receptor for von Willebrand factor. The complete receptor complex includes noncovalent association of the alpha and beta subunits with the protein encoded by this gene and platelet glycoprotein V. Defects in this gene are a cause of Bernard-Soulier syndrome, also known as giant platelet disease. These patients have unusually large platelets and have a clinical bleeding tendency. [provided by RefSeq, Oct 2008]

Uniprot Description

The GPIb-V-IX complex functions as the vWF receptor and mediates vWF-dependent platelet adhesion to blood vessels. The adhesion of platelets to injured vascular surfaces in the arterial circulation is a critical initiating event in hemostasis. GP-IX may provide for membrane insertion and orientation of GP-Ib.

Research Articles on GP9

Similar Products

Product Notes

The GP9 gp9 (Catalog #AAA3215261) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GP9 antibody - middle region reacts with Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's GP9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GP9 gp9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NSLQSVPPGA FDHLPQLQTL DVTQNPWHCD CSLTYLRLWL EDRTPEALLQ. It is sometimes possible for the material contained within the vial of "GP9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.