Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-UQCRC1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Rabbit UQCRC1 Polyclonal Antibody | anti-UQCRC1 antibody

UQCRC1 antibody - N-terminal region

Gene Names
UQCRC1; QCR1; UQCR1; D3S3191
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UQCRC1; Polyclonal Antibody; UQCRC1 antibody - N-terminal region; anti-UQCRC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AVELLGDIVQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAF
Sequence Length
480
Applicable Applications for anti-UQCRC1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Yeast: 75%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-UQCRC1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Western Blot (WB) (WB Suggested Anti-UQCRC1 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
Related Product Information for anti-UQCRC1 antibody
This is a rabbit polyclonal antibody against UQCRC1. It was validated on Western Blot

Target Description: UQCRC1 is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.
Product Categories/Family for anti-UQCRC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
cytochrome b-c1 complex subunit 1, mitochondrial
NCBI Official Synonym Full Names
ubiquinol-cytochrome c reductase core protein 1
NCBI Official Symbol
UQCRC1
NCBI Official Synonym Symbols
QCR1; UQCR1; D3S3191
NCBI Protein Information
cytochrome b-c1 complex subunit 1, mitochondrial
UniProt Protein Name
Cytochrome b-c1 complex subunit 1, mitochondrial
UniProt Gene Name
UQCRC1
UniProt Entry Name
QCR1_HUMAN

Uniprot Description

UQCRC1: This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1. Belongs to the peptidase M16 family. UQCRC1/QCR1 subfamily.

Protein type: EC 1.10.2.2; Mitochondrial; Energy Metabolism - oxidative phosphorylation; Oxidoreductase

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial respiratory chain complex III; mitochondrial respiratory chain

Molecular Function: metal ion binding; ubiquinol-cytochrome-c reductase activity; protein complex binding

Biological Process: response to alkaloid; cellular metabolic process; aerobic respiration; response to activity; oxidative phosphorylation; mitochondrial electron transport, ubiquinol to cytochrome c

Research Articles on UQCRC1

Similar Products

Product Notes

The UQCRC1 uqcrc1 (Catalog #AAA3215205) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UQCRC1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's UQCRC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the UQCRC1 uqcrc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AVELLGDIVQ NCSLEDSQIE KERDVILREM QENDASMRDV VFNYLHATAF. It is sometimes possible for the material contained within the vial of "UQCRC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.