Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HCCS AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)

Rabbit HCCS Polyclonal Antibody | anti-HCCS antibody

HCCS antibody - N-terminal region

Gene Names
HCCS; MLS; CCHL; MCOPS7; LSDMCA1
Reactivity
Dog, Horse, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HCCS; Polyclonal Antibody; HCCS antibody - N-terminal region; anti-HCCS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTV
Sequence Length
268
Applicable Applications for anti-HCCS antibody
Western Blot (WB)
Homology
Dog: 100%; Horse: 85%; Human: 100%; Rat: 85%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HCCS AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)

Western Blot (WB) (WB Suggested Anti-HCCS AntibodyTitration: 1.0 ug/mlPositive Control: U937 Whole Cell)
Related Product Information for anti-HCCS antibody
This is a rabbit polyclonal antibody against HCCS. It was validated on Western Blot

Target Description: The protein encoded by this gene is an enzyme that covalently links a heme group to the apoprotein of cytochrome c. Defects in this gene are a cause of microphthalmia syndromic type 7 (MCOPS7). Three transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-HCCS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
cytochrome c-type heme lyase
NCBI Official Synonym Full Names
holocytochrome c synthase
NCBI Official Symbol
HCCS
NCBI Official Synonym Symbols
MLS; CCHL; MCOPS7; LSDMCA1
NCBI Protein Information
cytochrome c-type heme lyase
UniProt Protein Name
Cytochrome c-type heme lyase
UniProt Gene Name
HCCS
UniProt Synonym Gene Names
CCHL; CCHL
UniProt Entry Name
CCHL_HUMAN

NCBI Description

The protein encoded by this gene is an enzyme that covalently links a heme group to the apoprotein of cytochrome c. Defects in this gene are a cause of microphthalmia syndromic type 7 (MCOPS7). Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jan 2010]

Uniprot Description

HCCS: Links covalently the heme group to the apoprotein of cytochrome c. Defects in HCCS are a cause of microphthalmia syndromic type 7 (MCOPS7); also known as microphthalmia with linear skin defects (MLS) or MIDAS syndrome. Microphthalmia is a clinically heterogeneous disorder of eye formation, ranging from small size of a single eye TO complete bilateral absence of ocular tissues (anophthalmia). In many cases, microphthalmia/anophthalmia occurs in association with syndromes that include non-ocular abnormalities. MCOPS7 is a disorder characterized by unilateral or bilateral microphthalmia, linear skin defects in affected females, and in utero lethality for males. Skin defects are limited to the face and neck, consisting of areas of aplastic skin that heal with age to form hyperpigmented areas. Additional features in female patients include agenesis of the corpus callosum, sclerocornea, chorioretinal abnormalities, infantile seizures, congenital heart defect, mental retardation, and diaphragmatic hernia. Belongs to the cytochrome c-type heme lyase family.

Protein type: Mitochondrial; EC 4.4.1.17; Lyase; Cofactor and Vitamin Metabolism - porphyrin and chlorophyll

Chromosomal Location of Human Ortholog: Xp22.3

Cellular Component: mitochondrion; mitochondrial inner membrane

Molecular Function: metal ion binding; holocytochrome-c synthase activity

Biological Process: organ morphogenesis

Disease: Microphthalmia, Syndromic 7

Research Articles on HCCS

Similar Products

Product Notes

The HCCS hccs (Catalog #AAA3215072) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HCCS antibody - N-terminal region reacts with Dog, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HCCS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HCCS hccs for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PAHQERAYEY VECPIRGTAA ENKENLDPSN LMPPPNQTPA PDQPFALSTV. It is sometimes possible for the material contained within the vial of "HCCS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.