Western Blot (WB)
(WB Suggested Anti-DOK4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateThere is BioGPS gene expression data showing that DOK4 is expressed in 721_B)
Rabbit DOK4 Polyclonal Antibody | anti-DOK4 antibody
DOK4 antibody - N-terminal region
Gene Names
DOK4; IRS5; IRS-5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DOK4; Polyclonal Antibody; DOK4 antibody - N-terminal region; anti-DOK4 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GPQRLEKYPDEKSVCLRGCPKVTEISNVKCVTRLPKETKRQAVAIIFTDD
Sequence Length
326
Applicable Applications for anti-DOK4 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DOK4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-DOK4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateThere is BioGPS gene expression data showing that DOK4 is expressed in 721_B)
Western Blot (WB)
(WB Suggested Anti-DOK4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 721_B cell lysateThere is BioGPS gene expression data showing that DOK4 is expressed in 721_B)
Related Product Information for anti-DOK4 antibody
This is a rabbit polyclonal antibody against DOK4. It was validated on Western Blot
Target Description: DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK4 functions in RET-mediated neurite outgrowth and plays a positive role in activation of the MAP kinase pathway
Target Description: DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK4 functions in RET-mediated neurite outgrowth and plays a positive role in activation of the MAP kinase pathway
Product Categories/Family for anti-DOK4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
docking protein 4 isoform 1
NCBI Official Synonym Full Names
docking protein 4
NCBI Official Symbol
DOK4
NCBI Official Synonym Symbols
IRS5; IRS-5
NCBI Protein Information
docking protein 4
UniProt Protein Name
Docking protein 4
Protein Family
UniProt Gene Name
DOK4
UniProt Synonym Gene Names
IRS-5; IRS5
UniProt Entry Name
DOK4_HUMAN
Uniprot Description
DOK4: docking proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK4 functions in Ret-mediated neurite outgrowth and plays a positive role in activation of the MAP kinase pathway. Putative link with downstream effectors of Ret in neuronal differentiation. May be involved in the regulation of the immune response induced by T-cells. Interacts with Ret and TIE2. Interaction with Ret is mediated through the PTB domain and requires phosphorylation of Ret Y1062.
Protein type: Adaptor/scaffold; Cell development/differentiation
Chromosomal Location of Human Ortholog: 16q21
Molecular Function: protein binding; receptor signaling protein activity; insulin receptor binding
Biological Process: nervous system development; MAPKKK cascade; transmembrane receptor protein tyrosine kinase signaling pathway
Research Articles on DOK4
1. the current study have explored in more detail the structure and function of the Dok-4 PTB domain.
Similar Products
Product Notes
The DOK4 dok4 (Catalog #AAA3214715) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DOK4 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DOK4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DOK4 dok4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GPQRLEKYPD EKSVCLRGCP KVTEISNVKC VTRLPKETKR QAVAIIFTDD. It is sometimes possible for the material contained within the vial of "DOK4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
