Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: OPN1MWSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Rabbit OPN1LW Polyclonal Antibody | anti-OPN1LW antibody

OPN1LW Antibody - C-terminal region

Gene Names
OPN1LW; CBP; RCP; ROP; CBBM; COD5
Reactivity
Tested Species Reactivity: Human, Mouse (Predicted Species Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat)
Purity
Affinity Purified
Synonyms
OPN1LW; Polyclonal Antibody; OPN1LW Antibody - C-terminal region; anti-OPN1LW antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Species Reactivity: Human, Mouse (Predicted Species Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat)
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Protein Size (# AA)
364 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human OPN1MW.
Predicted Homology Based on Immunogen Sequence
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide Sequence
Synthetic peptide located within the following region: SIIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFCWG
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles

Western Blot (WB)

(Host: MouseTarget Name: OPN1MWSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: OPN1MWSample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: OPN1MWSample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: OPN1MWSample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-OPN1LW antibody
This is a rabbit polyclonal antibody against OPN1MW. It was validated on Western Blot
Product Categories/Family for anti-OPN1LW antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
red pigment protein
NCBI Official Synonym Full Names
opsin 1, long wave sensitive
NCBI Official Symbol
OPN1LW
NCBI Official Synonym Symbols
CBP; RCP; ROP; CBBM; COD5
NCBI Protein Information
long-wave-sensitive opsin 1
UniProt Protein Name
Long-wave-sensitive opsin 1
Protein Family
UniProt Gene Name
OPN1LW
UniProt Synonym Gene Names
RCP; ROP
UniProt Entry Name
OPSR_HUMAN

NCBI Description

This gene encodes for a light absorbing visual pigment of the opsin gene family. The encoded protein is called red cone photopigment or long-wavelength sensitive opsin. Opsins are G-protein coupled receptors with seven transmembrane domains, an N-terminal extracellular domain, and a C-terminal cytoplasmic domain. This gene and the medium-wavelength opsin gene are tandemly arrayed on the X chromosome and frequent unequal recombination and gene conversion may occur between these sequences. X chromosomes may have fusions of the medium- and long-wavelength opsin genes or may have more than one copy of these genes. Defects in this gene are the cause of partial, protanopic colorblindness. [provided by RefSeq, Jul 2008]

Uniprot Description

OPN1LW: Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal. Defects in OPN1LW are the cause of partial colorblindness protan series (CBP); also known as protanopia. Defects in OPN1LW are a cause of blue cone monochromacy (BCM). A rare X-linked congenital stationary cone dysfunction syndrome characterized by the absence of functional long wavelength-sensitive and medium wavelength-sensitive cones in the retina. Color discrimination is severely impaired from birth, and vision is derived from the remaining preserved blue (S) cones and rod photoreceptors. BCM typically presents with reduced visual acuity, pendular nystagmus, and photophobia. Patients often have myopia. Belongs to the G-protein coupled receptor 1 family. Opsin subfamily.

Protein type: Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 1

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: integral to plasma membrane

Molecular Function: G-protein coupled receptor activity; photoreceptor activity

Biological Process: positive regulation of cytokinesis; G-protein coupled receptor protein signaling pathway; phototransduction, visible light; visual perception; retinoid metabolic process; signal transduction; protein-chromophore linkage

Disease: Blue Cone Monochromacy; Colorblindness, Partial, Protan Series

Research Articles on OPN1LW

Similar Products

Product Notes

The OPN1LW opn1lw (Catalog #AAA3214494) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OPN1LW Antibody - C-terminal region reacts with Tested Species Reactivity: Human, Mouse (Predicted Species Reactivity: Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat) and may cross-react with other species as described in the data sheet. It is sometimes possible for the material contained within the vial of "OPN1LW, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.