Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-VCP AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic, nucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit VCP Polyclonal Antibody | anti-VCP antibody

VCP antibody - C-terminal region

Gene Names
VCP; p97; TERA; CDC48
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Affinity Purified
Synonyms
VCP; Polyclonal Antibody; VCP antibody - C-terminal region; anti-VCP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLY
Sequence Length
806
Applicable Applications for anti-VCP antibody
Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human VCP
Conjugation
Unconjugated
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-VCP AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic, nucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-VCP AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic, nucleusPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-VCP antibody
This is a rabbit polyclonal antibody against VCP. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of a family that includes putative ATP-binding proteins involved in vesicle transport and fusion, 26S proteasome function, and assembly of peroxisomes. This protein, as a structural protein, is associated with clathrin, and heat-shock protein Hsc70, to form a complex. It has been implicated in a number of cellular events that are regulated during mitosis, including homotypic membrane fusion, spindle pole body function, and ubiquitin-dependent protein degradation.
Product Categories/Family for anti-VCP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89kDa
NCBI Official Full Name
transitional endoplasmic reticulum ATPase isoform 1
NCBI Official Synonym Full Names
valosin containing protein
NCBI Official Symbol
VCP
NCBI Official Synonym Symbols
p97; TERA; CDC48
NCBI Protein Information
transitional endoplasmic reticulum ATPase
UniProt Protein Name
Transitional endoplasmic reticulum ATPase
Protein Family
UniProt Gene Name
VCP
UniProt Synonym Gene Names
TER ATPase; VCP
UniProt Entry Name
TERA_HUMAN

NCBI Description

This gene encodes a member of the AAA ATPase family of proteins. The encoded protein plays a role in protein degradation, intracellular membrane fusion, DNA repair and replication, regulation of the cell cycle, and activation of the NF-kappa B pathway. This protein forms a homohexameric complex that interacts with a variety of cofactors and extracts ubiquitinated proteins from lipid membranes or protein complexes. Mutations in this gene cause IBMPFD (inclusion body myopathy with paget disease of bone and frontotemporal dementia), ALS (amyotrophic lateral sclerosis) and Charcot-Marie-Tooth disease in human patients. [provided by RefSeq, Aug 2017]

Uniprot Description

VCP: valosin-containing protein (VCP) is a member of a family that includes putative ATP-binding proteins involved in vesicle transport and fusion, 26S proteasome function, and assembly of peroxisomes. VCP, as a structural protein, is associated with clathrin, and heat-shock protein Hsc70, to form a complex. Necessary for the fragmentation of Golgi stacks during mitosis and for their reassembly after mitosis. Involved in the formation of the nuclear envelope and of the transitional endoplasmic reticulum (tER). Regulates NFKappaB pathway, which is important for metastasis of osteosarcoma. Tyrosine phosphorylation regulates its cell cycle-dependent nuclear localization.

Protein type: Chaperone; DNA repair, damage; Endoplasmic reticulum; Hydrolase; EC 3.6.4.6

Chromosomal Location of Human Ortholog: 9p13.3

Cellular Component: proteasome complex; nucleoplasm; endoplasmic reticulum membrane; intracellular membrane-bound organelle; perinuclear region of cytoplasm; endoplasmic reticulum; cytoplasm; lipid particle; cytosol; nucleus

Molecular Function: protein domain specific binding; identical protein binding; protein binding; ATPase activity; protein complex binding; ADP binding; polyubiquitin binding; protein phosphatase binding; lipid binding; ATP binding; receptor binding

Biological Process: caspase activation; proteasomal ubiquitin-dependent protein catabolic process; ER to Golgi vesicle-mediated transport; ER-associated protein catabolic process; unfolded protein response; protein ubiquitination; DNA repair; retrograde protein transport, ER to cytosol; regulation of apoptosis; bypass DNA synthesis; establishment of protein localization; positive regulation of protein complex assembly; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; double-strand break repair; positive regulation of protein catabolic process; protein amino acid N-linked glycosylation via asparagine; response to DNA damage stimulus; protein homooligomerization

Disease: Inclusion Body Myopathy With Early-onset Paget Disease With Or Without Frontotemporal Dementia 1; Amyotrophic Lateral Sclerosis 14, With Or Without Frontotemporal Dementia

Research Articles on VCP

Similar Products

Product Notes

The VCP vcp (Catalog #AAA3214308) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VCP antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's VCP can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB). Researchers should empirically determine the suitability of the VCP vcp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EMFAQTLQQS RGFGSFRFPS GNQGGAGPSQ GSGGGTGGSV YTEDNDDDLY. It is sometimes possible for the material contained within the vial of "VCP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.