Western Blot (WB)
(WB Suggested Anti-TNKS1BP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Rabbit anti-Human TNKS1BP1 Polyclonal Antibody | anti-TNKS1BP1 antibody
TNKS1BP1 antibody - middle region
Gene Names
TNKS1BP1; TAB182
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TNKS1BP1; Polyclonal Antibody; TNKS1BP1 antibody - middle region; anti-TNKS1BP1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DGEASQTEDVDGTWGSSAARWSDQGPAQTSRRPSQGPPARSPSQDFSFIE
Sequence Length
1729
Applicable Applications for anti-TNKS1BP1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TNKS1BP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TNKS1BP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Western Blot (WB)
(WB Suggested Anti-TNKS1BP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Related Product Information for anti-TNKS1BP1 antibody
This is a rabbit polyclonal antibody against TNKS1BP1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TNKS-1 mRNA in urine sediment from patients with bladder TCC correlated with tumor stage, and higher preoperative levels were associated with increased risk of early recurrence. Tankyrase-1 is required in the assembly of bipolar spindles and the spindle-pole protein NuMA as a substrate for covalent modification by tankyrase-1. Data also show that tankyrase 1 inhibition in human cancer cells enhances telomere shortening by a telomerase inhibitor and hastens cell death.
Target Description: TNKS-1 mRNA in urine sediment from patients with bladder TCC correlated with tumor stage, and higher preoperative levels were associated with increased risk of early recurrence. Tankyrase-1 is required in the assembly of bipolar spindles and the spindle-pole protein NuMA as a substrate for covalent modification by tankyrase-1. Data also show that tankyrase 1 inhibition in human cancer cells enhances telomere shortening by a telomerase inhibitor and hastens cell death.
Product Categories/Family for anti-TNKS1BP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
190kDa
NCBI Official Full Name
182 kDa tankyrase-1-binding protein
NCBI Official Synonym Full Names
tankyrase 1 binding protein 1
NCBI Official Symbol
TNKS1BP1
NCBI Official Synonym Symbols
TAB182
NCBI Protein Information
182 kDa tankyrase-1-binding protein
UniProt Protein Name
182 kDa tankyrase-1-binding protein
Protein Family
UniProt Gene Name
TNKS1BP1
UniProt Synonym Gene Names
KIAA1741; TAB182
UniProt Entry Name
TB182_HUMAN
Uniprot Description
TNKS1BP1: 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Actin-binding; Cell cycle regulation
Chromosomal Location of Human Ortholog: 11q12.1
Cellular Component: nucleoplasm; cytoskeleton; cytoplasm; nuclear telomeric heterochromatin; plasma membrane; cytosol; nucleus; CCR4-NOT complex
Molecular Function: enzyme binding; ankyrin binding
Biological Process: poly(A) tail shortening; gene expression; telomere maintenance via telomerase; mRNA catabolic process, deadenylation-dependent decay
Research Articles on TNKS1BP1
Similar Products
Product Notes
The TNKS1BP1 tnks1bp1 (Catalog #AAA3213850) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNKS1BP1 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TNKS1BP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TNKS1BP1 tnks1bp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DGEASQTEDV DGTWGSSAAR WSDQGPAQTS RRPSQGPPAR SPSQDFSFIE. It is sometimes possible for the material contained within the vial of "TNKS1BP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
