Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CAMK1G Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Rabbit CAMK1G Polyclonal Antibody | anti-CAMK1G antibody

CAMK1G antibody - middle region

Gene Names
CAMK1G; VWS1; CLICK3; CLICKIII; dJ272L16.1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CAMK1G; Polyclonal Antibody; CAMK1G antibody - middle region; anti-CAMK1G antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KDFICHLLEKDPNERYTCEKALSHPWIDGNTALHRDIYPSVSLQIQKNFA
Sequence Length
476
Applicable Applications for anti-CAMK1G antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CAMK1G
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CAMK1G Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-CAMK1G Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Related Product Information for anti-CAMK1G antibody
This is a rabbit polyclonal antibody against CAMK1G. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a protein similar to calcium/calmodulin dependent protein kinase, however, its exact function is not known.
Product Categories/Family for anti-CAMK1G antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
calcium/calmodulin-dependent protein kinase type 1G
NCBI Official Synonym Full Names
calcium/calmodulin dependent protein kinase IG
NCBI Official Symbol
CAMK1G
NCBI Official Synonym Symbols
VWS1; CLICK3; CLICKIII; dJ272L16.1
NCBI Protein Information
calcium/calmodulin-dependent protein kinase type 1G
UniProt Protein Name
Calcium/calmodulin-dependent protein kinase type 1G
UniProt Gene Name
CAMK1G
UniProt Synonym Gene Names
CLICK3; VWS1; CaM kinase IG; CaM-KI gamma; CaMKI gamma; CaMKIG; CLICK III
UniProt Entry Name
KCC1G_HUMAN

NCBI Description

This gene encodes a protein similar to calcium/calmodulin dependent protein kinase, however, its exact function is not known. [provided by RefSeq, Jul 2008]

Uniprot Description

CAMK1G: Calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade. In vitro phosphorylates transcription factor CREB1. Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. CaMK subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, CAMK; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.17; CAMK group; CAMK1 family

Chromosomal Location of Human Ortholog: 1q32.2

Cellular Component: Golgi membrane; neuron projection; plasma membrane; calcium- and calmodulin-dependent protein kinase complex

Molecular Function: calmodulin binding; calmodulin-dependent protein kinase activity; ATP binding

Biological Process: protein amino acid phosphorylation

Research Articles on CAMK1G

Similar Products

Product Notes

The CAMK1G camk1g (Catalog #AAA3213353) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAMK1G antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CAMK1G can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAMK1G camk1g for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KDFICHLLEK DPNERYTCEK ALSHPWIDGN TALHRDIYPS VSLQIQKNFA. It is sometimes possible for the material contained within the vial of "CAMK1G, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.