Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Ahi1 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Lung)

Rabbit Ahi1 Polyclonal Antibody | anti-AHI1 antibody

Ahi1 antibody - C-terminal region

Gene Names
Ahi1; Ahi-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Ahi1; Polyclonal Antibody; Ahi1 antibody - C-terminal region; anti-AHI1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KDSTLRIMDLRILAARKFVGAANYREKIHSTLTPCGTLLFSGSEDGIVYV
Sequence Length
1047
Applicable Applications for anti-AHI1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Ahi1 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Lung)

Western Blot (WB) (WB Suggested Anti-Ahi1 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Lung)
Related Product Information for anti-AHI1 antibody
This is a rabbit polyclonal antibody against Ahi1. It was validated on Western Blot

Target Description: Mutations in the human homolog are associated with Joubert syndrome, an autosomal recessive disorder resulting in severe mental retardation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
120kDa
NCBI Official Full Name
jouberin
NCBI Official Synonym Full Names
Abelson helper integration site 1
NCBI Official Symbol
Ahi1
NCBI Official Synonym Symbols
Ahi-1
NCBI Protein Information
jouberin
UniProt Protein Name
Jouberin
Protein Family
UniProt Gene Name
Ahi1
UniProt Synonym Gene Names
AHI-1
UniProt Entry Name
AHI1_RAT

NCBI Description

mutations in the human homolog are associated with Joubert syndrome, an autosomal recessive disorder resulting in severe cognitive disability [RGD, Feb 2006]

Uniprot Description

AHI1: Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes (By similarity)

Protein type: Adaptor/scaffold

Cellular Component: centriole; centrosome; photoreceptor outer segment; adherens junction; nonmotile primary cilium; intercellular junction; cilium

Molecular Function: identical protein binding

Biological Process: positive regulation of polarized epithelial cell differentiation; central nervous system development; vesicle targeting; positive regulation of receptor internalization; specification of axis polarity; vesicle-mediated transport; retina development in camera-type eye; protein localization in organelle; cilium biogenesis; positive regulation of transcription from RNA polymerase II promoter; heart looping; transmembrane receptor protein tyrosine kinase signaling pathway; morphogenesis of a polarized epithelium; regulation of behavior; hindbrain development; negative regulation of apoptosis

Research Articles on AHI1

Similar Products

Product Notes

The AHI1 ahi1 (Catalog #AAA3213121) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ahi1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Ahi1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AHI1 ahi1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KDSTLRIMDL RILAARKFVG AANYREKIHS TLTPCGTLLF SGSEDGIVYV. It is sometimes possible for the material contained within the vial of "Ahi1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.