Western Blot (WB)
(WB Suggested Anti-TRIML2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Rabbit anti-Human TRIML2 Polyclonal Antibody | anti-TRIML2 antibody
TRIML2 antibody - middle region
Gene Names
TRIML2; SPRYD6
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TRIML2; Polyclonal Antibody; TRIML2 antibody - middle region; anti-TRIML2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SEDLRTMRLRHGQQDGAGNPERLDFSAMVLAAESFTSGRHYWEVDVEKAT
Sequence Length
387
Applicable Applications for anti-TRIML2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TRIML2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TRIML2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Western Blot (WB)
(WB Suggested Anti-TRIML2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Related Product Information for anti-TRIML2 antibody
This is a rabbit polyclonal antibody against TRIML2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The specific function of TRIML2 is not yet known.
Target Description: The specific function of TRIML2 is not yet known.
Product Categories/Family for anti-TRIML2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
probable E3 ubiquitin-protein ligase TRIML2 isoform 2
NCBI Official Synonym Full Names
tripartite motif family like 2
NCBI Official Symbol
TRIML2
NCBI Official Synonym Symbols
SPRYD6
NCBI Protein Information
probable E3 ubiquitin-protein ligase TRIML2
UniProt Protein Name
Probable E3 ubiquitin-protein ligase TRIML2
Protein Family
UniProt Gene Name
TRIML2
UniProt Synonym Gene Names
SPRYD6
NCBI Description
This gene encodes a member of the tri-partite motif (TRIM) family of proteins. This protein may be regulated by the tumor suppressor p53 and may regulate p53 through the enhancement of p53 SUMOylation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]
Research Articles on TRIML2
Similar Products
Product Notes
The TRIML2 triml2 (Catalog #AAA3212323) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRIML2 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIML2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRIML2 triml2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SEDLRTMRLR HGQQDGAGNP ERLDFSAMVL AAESFTSGRH YWEVDVEKAT. It is sometimes possible for the material contained within the vial of "TRIML2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
