<
Western Blot (WB)
(Human Jurkat Whole CellHost: RabbitTarget Name: KRASSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)
Rabbit KRAS Polyclonal Antibody | anti-KRAS antibody
KRAS antibody - N-terminal region
Gene Names
KRAS; NS; NS3; CFC2; RALD; K-Ras; KRAS1; KRAS2; RASK2; KI-RAS; C-K-RAS; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; c-Ki-ras2
Reactivity
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, ZebrafishTested Species Reactivty: Human , Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KRAS; Polyclonal Antibody; KRAS antibody - N-terminal region; anti-KRAS antibody
Host
Rabbit
Reactivity
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Tested Species Reactivty: Human , Mouse
Tested Species Reactivty: Human , Mouse
Clonality
Polyclonal
Specificity
100% homologous to human KRAS, NRAS and HRAS.
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range : 100ul at 0.5-1 mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETC
Sequence Length
189
Applicable Applications for anti-KRAS antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KRAS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Human Jurkat Whole CellHost: RabbitTarget Name: KRASSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Human Jurkat Whole CellHost: RabbitTarget Name: KRASSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Human DLD1 Whole CellHost: RabbitTarget Name: KRASSample Tissue: Human DLD1 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Human DLD1 Whole CellHost: RabbitTarget Name: KRASSample Tissue: Human DLD1 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Mouse KidneyHost: MouseTarget Name: KRASSample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Mouse KidneyHost: MouseTarget Name: KRASSample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Human HeartWB Suggested Anti-KRAS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)
Western Blot (WB)
(Human HeartWB Suggested Anti-KRAS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)
Western Blot (WB)
(Human MCF7 Whole CellHost: RabbitTarget Name: KRASSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Human MCF7 Whole CellHost: RabbitTarget Name: KRASSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Human A549 Whole CellHost: RabbitTarget Name: KRASSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Human A549 Whole CellHost: RabbitTarget Name: KRASSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Human stomach, Human liverHost: RabbitTarget: KRASPositive control (+): Human stomach (ST)Negative control (-): Human liver (LI)Antibody concentration: 3ug/ml)
Western Blot (WB)
(Human stomach, Human liverHost: RabbitTarget: KRASPositive control (+): Human stomach (ST)Negative control (-): Human liver (LI)Antibody concentration: 3ug/ml)
Western Blot (WB)
(Human RPMI-8226WB Suggested Anti-KRAS antibody Titration: 1 ug/mLSample Type: Human RPMI-8226)
Western Blot (WB)
(Human RPMI-8226WB Suggested Anti-KRAS antibody Titration: 1 ug/mLSample Type: Human RPMI-8226)
Related Product Information for anti-KRAS antibody
This is a rabbit polyclonal antibody against KRAS. It was validated on Western Blot
Target Description: KRAS is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma.
Target Description: KRAS is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma.
Product Categories/Family for anti-KRAS antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22kDa
NCBI Official Full Name
GTPase KRas isoform a
NCBI Official Synonym Full Names
KRAS proto-oncogene, GTPase
NCBI Official Symbol
KRAS
NCBI Official Synonym Symbols
NS; NS3; CFC2; RALD; K-Ras; KRAS1; KRAS2; RASK2; KI-RAS; C-K-RAS; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; c-Ki-ras2
NCBI Protein Information
GTPase KRas
UniProt Protein Name
GTPase NRas
Protein Family
UniProt Gene Name
NRAS
UniProt Synonym Gene Names
HRAS1
UniProt Entry Name
RASN_HUMAN
NCBI Description
This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region. [provided by RefSeq, Jul 2008]
Research Articles on KRAS
Similar Products
Product Notes
The KRAS nras (Catalog #AAA3212206) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KRAS antibody - N-terminal region reacts with Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish Tested Species Reactivty: Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's KRAS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KRAS nras for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TEYKLVVVGA GGVGKSALTI QLIQNHFVDE YDPTIEDSYR KQVVIDGETC. It is sometimes possible for the material contained within the vial of "KRAS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
