Western Blot (WB)
(WB Suggested Anti-RP11-529I10.4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)
Rabbit RP11-529I10.4 Polyclonal Antibody | anti-DPCD antibody
RP11-529I10.4 antibody - middle region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RP11-529I10.4; Polyclonal Antibody; RP11-529I10.4 antibody - middle region; anti-DPCD antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: APLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVD
Sequence Length
203
Applicable Applications for anti-DPCD antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RP11-529I10.4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-RP11-529I10.4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)
Western Blot (WB)
(WB Suggested Anti-RP11-529I10.4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)
Related Product Information for anti-DPCD antibody
This is a rabbit polyclonal antibody against RP11-529I10.4. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: RP11-529I10.4 (DPCD) belongs to the DPCD family. It may play a role in the formation or function of ciliated cells. Deletion of the DPCD gene may be a cause of primary ciliary dyskinesia (PCD).
Target Description: RP11-529I10.4 (DPCD) belongs to the DPCD family. It may play a role in the formation or function of ciliated cells. Deletion of the DPCD gene may be a cause of primary ciliary dyskinesia (PCD).
Product Categories/Family for anti-DPCD antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
protein DPCD isoform 2
NCBI Official Synonym Full Names
deleted in primary ciliary dyskinesia homolog (mouse)
NCBI Official Symbol
DPCD
NCBI Protein Information
protein DPCD
UniProt Protein Name
Protein DPCD
Protein Family
UniProt Gene Name
DPCD
UniProt Entry Name
DPCD_HUMAN
NCBI Description
This gene in mouse encodes a protein that may be involved in the generation and maintenance of ciliated cells. In mouse, expression of this gene increases during ciliated cell differentiation, and disruption of this gene has been linked to primary ciliary dyskinesia. [provided by RefSeq, Jul 2016]
Research Articles on DPCD
Similar Products
Product Notes
The DPCD dpcd (Catalog #AAA3212120) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RP11-529I10.4 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RP11-529I10.4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DPCD dpcd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: APLGAGNLGP ELIKESNANP IFMRKDTKMS FQWRIRNLPY PKDVYSVSVD. It is sometimes possible for the material contained within the vial of "RP11-529I10.4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
