Western Blot (WB)
(WB Suggested Anti-Rpsa AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Rabbit Rpsa Polyclonal Antibody | anti-RPSA antibody
Rpsa antibody - N-terminal region
Gene Names
Rpsa; MLR; P40; 67lr; Lamr; 67kDa; Lamr1; P40-3; P40-8; Lamrl1; AL022858
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Rpsa; Polyclonal Antibody; Rpsa antibody - N-terminal region; anti-RPSA antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKL
Sequence Length
295
Applicable Applications for anti-RPSA antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Rpsa AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Western Blot (WB)
(WB Suggested Anti-Rpsa AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Heart)
Related Product Information for anti-RPSA antibody
This is a rabbit polyclonal antibody against Rpsa. It was validated on Western Blot
Target Description: Rpsa is required for the assembly and/or stability of the 40S ribosomal subunit. It is also required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. It slso functions as a cell surface receptor for laminin. It plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. It may play a role in cell fate determination and tissue morphogenesis. It also acts as a receptor for several other ligands, including the pathogenic prion protein, viruses, and bacteria. It enables malignant tumor cells to penetrate laminin tissue and vessel barriers and activates precursor thymic anti-OFA/iLRP specific cytotoxic T cell. It may induce CD8 T-suppressor cells secreting IL-10.
Target Description: Rpsa is required for the assembly and/or stability of the 40S ribosomal subunit. It is also required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. It slso functions as a cell surface receptor for laminin. It plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. It may play a role in cell fate determination and tissue morphogenesis. It also acts as a receptor for several other ligands, including the pathogenic prion protein, viruses, and bacteria. It enables malignant tumor cells to penetrate laminin tissue and vessel barriers and activates precursor thymic anti-OFA/iLRP specific cytotoxic T cell. It may induce CD8 T-suppressor cells secreting IL-10.
Product Categories/Family for anti-RPSA antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
40S ribosomal protein SA
NCBI Official Synonym Full Names
ribosomal protein SA
NCBI Official Symbol
Rpsa
NCBI Official Synonym Symbols
MLR; P40; 67lr; Lamr; 67kDa; Lamr1; P40-3; P40-8; Lamrl1; AL022858
NCBI Protein Information
40S ribosomal protein SA
UniProt Protein Name
40S ribosomal protein SA
Protein Family
UniProt Gene Name
Rpsa
UniProt Synonym Gene Names
Lamr1; P40-8; 37LRP; LRP/LR; 67LR; LamR; LBP/p40
UniProt Entry Name
RSSA_MOUSE
Research Articles on RPSA
Similar Products
Product Notes
The RPSA rpsa (Catalog #AAA3211798) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Rpsa antibody - N-terminal region reacts with Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Rpsa can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RPSA rpsa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QMKEEDVLKF LAAGTHLGGT NLDFQMEQYI YKRKSDGIYI INLKRTWEKL. It is sometimes possible for the material contained within the vial of "Rpsa, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
