Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PIWIL4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)

Rabbit anti-Human PIWIL4 Polyclonal Antibody | anti-PIWIL4 antibody

PIWIL4 antibody - N-terminal region

Gene Names
PIWIL4; HIWI2; MIWI2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PIWIL4; Polyclonal Antibody; PIWIL4 antibody - N-terminal region; anti-PIWIL4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSR
Sequence Length
852
Applicable Applications for anti-PIWIL4 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PIWIL4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PIWIL4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-PIWIL4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)
Related Product Information for anti-PIWIL4 antibody
This is a rabbit polyclonal antibody against PIWIL4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells (Sasaki et al., 2003 [PubMed 12906857]).[supplied by OMIM].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
96kDa
NCBI Official Full Name
piwi-like protein 4
NCBI Official Synonym Full Names
piwi like RNA-mediated gene silencing 4
NCBI Official Symbol
PIWIL4
NCBI Official Synonym Symbols
HIWI2; MIWI2
NCBI Protein Information
piwi-like protein 4
UniProt Protein Name
Piwi-like protein 4
Protein Family
UniProt Gene Name
PIWIL4
UniProt Synonym Gene Names
HIWI2; PIWI
UniProt Entry Name
PIWL4_HUMAN

NCBI Description

PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells (Sasaki et al., 2003 [PubMed 12906857]).[supplied by OMIM, Mar 2008]

Uniprot Description

PIWIL4: Plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Directly binds piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. Associates with secondary piRNAs antisense and PIWIL2/MILI is required for such association. The piRNA process acts upstream of known mediators of DNA methylation. Participates in a piRNA amplification loop. Besides their function in transposable elements repression, piRNAs are probably involved in other processes during meiosis such as translation regulation. May be involved in the chromatin-modifying pathway by inducing 'Lys-9' methylation of histone H3 at some loci. Belongs to the argonaute family. Piwi subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 11q21

Cellular Component: cytoplasm; nucleus

Biological Process: regulation of translation; meiotic cell cycle; DNA methylation during gametogenesis; multicellular organismal development; spermatogenesis; RNA-mediated gene silencing; gene expression; cell differentiation

Research Articles on PIWIL4

Similar Products

Product Notes

The PIWIL4 piwil4 (Catalog #AAA3211065) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIWIL4 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIWIL4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PIWIL4 piwil4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGRARVKARG IARSPSATEV GRIQASPLPR SVDLSNNEAS SSNGFLGTSR. It is sometimes possible for the material contained within the vial of "PIWIL4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.